DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SCaMC and C42C1.19

DIOPT Version :9

Sequence 1:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001255630.1 Gene:C42C1.19 / 183402 WormBaseID:WBGene00302978 Length:403 Species:Caenorhabditis elegans


Alignment Length:246 Identity:52/246 - (21%)
Similarity:76/246 - (30%) Gaps:92/246 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 APETAFKF-------AAYEQMKRL-------------IRGDDGSRQMSI------VERFYAGAAA 388
            :|...|||       .||...:||             |..||..|.:||      |.:...|.||
 Worm     4 SPTNYFKFGAVFCIYVAYVLFRRLPIAFLSQIRTEIQISNDDIGRIVSIHASAFTVSKLVFGTAA 68

  Fly   389 ----------GGI------SQTIIYPMEVLKTRLALRRTGQYAGIADAAVKIYKQEGVRSFYRGY 437
                      |||      |..:.:..||.:..:.:...|...|                  .|:
 Worm    69 DRTSNSRLLIGGILLCSTSSIGLAFTSEVWQIEVVMAMIGSVQG------------------AGW 115

  Fly   438 VPNILGILPYAGIDLAVYETLKRRYIANHDNNEQPSFLVLLACGST---------SSTLGQLCSY 493
            ||....|..:  .|.|.|.|:                ..:|.||||         .::..:...:
 Worm   116 VPATKLIATW--FDDASYATM----------------FSVLGCGSTFAGMIVPLFKTSYWRTIEF 162

  Fly   494 PLALVRTRLQAQAAETIANQK--RKTQIPLKSSDAHSGEETMTGLFRKIVR 542
            ...:|.........:.|..:.  ||...|||..|..  ||...|: :||::
 Worm   163 NSGIVMLLFAIICKKWIITEDAIRKEVKPLKKEDME--EENTIGV-KKIMK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 9/39 (23%)
Mito_carr 375..463 CDD:278578 22/109 (20%)
Mito_carr 470..581 CDD:278578 18/84 (21%)
C42C1.19NP_001255630.1 MFS_OPA_SLC37 7..389 CDD:340870 51/243 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D442523at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.