DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and Smyd3

DIOPT Version :9

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_524768.2 Gene:Smyd3 / 44554 FlyBaseID:FBgn0011566 Length:468 Species:Drosophila melanogaster


Alignment Length:387 Identity:87/387 - (22%)
Similarity:143/387 - (36%) Gaps:99/387 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LRTGDVLLFEEPVAACLEPSYFGTHCHHCFKRLHTPVSCLHCSGIAFCSAQCMGEACSSYHRFEC 338
            ::.|..:|.|:|.|..|:..|....|.:|.:.... :.|.:|..:::|...|..:|... |:.||
  Fly    35 IKRGQRILTEKPFAFVLKSQYRLERCDNCLEATKV-LKCSNCRYVSYCHRSCQMQAWGQ-HKHEC 97

  Fly   339 EYM----DLMIGSGMSILCFIALRIFTQAPSLEQGLAT--ANLLFEHLCSHEEDRQPD------- 390
            .::    ..::.....:||.:.||: .....|.:|..|  .:..|..|.||..:.:.|       
  Fly    98 PFLKKVHPRVVPDAARMLCRLILRL-EHGGDLIRGYYTEHGSRKFRDLMSHYAEIKNDPMRLEHL 161

  Fly   391 DYLRRAL---MSGFLLRILQK----SLYFGRRKTEGVNPTAVEL-QVATALLGLLQVLQYNAHQI 447
            |.|...|   |:.....:..|    |:| ||..|.|.|....|: .:|||               
  Fly   162 DSLHAVLTDMMAESPSTVPNKTELMSIY-GRLITNGFNILDAEMNSIATA--------------- 210

  Fly   448 YQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACHFVGKKLVLTATRPHRANELVAVNY 512
                            :||..      |..:|.|.|:....|.|.:|     ..|...::..:::
  Fly   211 ----------------IYLGV------SITDHSCQPNAVATFEGNEL-----HVHAIEDMECLDW 248

  Fly   513 GPIFIK-----NNLKERQRSLRGRYSFSCSCMAC---QENWPLLQKLDKQVRFWCTSANCSNLLK 569
            ..|||.     |..::|:..|:..|.|.|.|..|   :|:..:|..|       |.:.||...:.
  Fly   249 SKIFISYIDLLNTPEQRRLDLKEHYYFLCVCSKCTDAKESKEMLAAL-------CPNRNCGAGIS 306

  Fly   570 FPKDLAKDVRCPRCRKNISLKESVAKMIKIEELYREA----ARAMEAQKTVEAIELFKESLD 627
            ..::     .||||...||        .|:...:.||    ...:|..|.|..:::.|..||
  Fly   307 VDRN-----NCPRCDAGIS--------PKLRNAFNEAMTLTRHNLENMKDVAYLDVCKVCLD 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150
zf-MYND 299..338 CDD:280009 8/38 (21%)
SET <474..513 CDD:279228 8/38 (21%)
Smyd3NP_524768.2 zf-MYND 60..97 CDD:280009 8/38 (21%)
TPR_12 377..440 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452061
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X437
43.740

Return to query results.
Submit another query.