DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and CG18213

DIOPT Version :9

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_650589.2 Gene:CG18213 / 42055 FlyBaseID:FBgn0038470 Length:879 Species:Drosophila melanogaster


Alignment Length:389 Identity:84/389 - (21%)
Similarity:138/389 - (35%) Gaps:143/389 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LFSAQRRAQADKLYL-MSGSGDG----------EESRELLQQALMAANLAVMRAPDRNADPVLDE 137
            ||....|...||::| .|...:|          .:|..:|:..|.:.:..:.|||  :|.|    
  Fly    36 LFLKILRKTTDKVFLDFSEVAEGCLNISKKCMNMKSPTVLKMTLQSLDEIICRAP--SASP---- 94

  Fly   138 GLTLALAYRSRASILIRLGEGEAALNDLKLAINFGLELKSSVDYYLKMAKAYAVMGEPARAEISL 202
              |...|..:|:.:.|:..:...|.|||.              ||..:        :||     |
  Fly    95 --TCVDAIMARSVLYIKNNQNTTACNDLL--------------YYESL--------DPA-----L 130

  Fly   203 KIAEKMPGCDATHIALC------------RKELSSVKPKPKEAT----SEQVPQLAHGES-AELV 250
            |.||   |...:.|..|            :.:||.||...::.|    ||..|.||..|. .|.:
  Fly   131 KTAE---GTIISQILHCICLFVNREYEASKDKLSVVKGLIEDGTLADRSEVSPFLALIEQHEERI 192

  Fly   251 GASKV----VRLVETK----------------------------DKGRFVVANEGLRTGDVLLFE 283
            ..:::    .:.|:|:                            :|...|.|:..:..|:::|.|
  Fly   193 NQARINVEFCKKVQTENFVPFKGFKLTRKIPFASQACDYSEKSIEKSGGVFASCDVPKGEIVLVE 257

  Fly   284 EPVAACLEPSYFG-----THCHHCFKRLHTPVSCLHCSGIAFCSAQCMGEACSSYHRFECEYMDL 343
            .||       ||.     .:|..|........:|.:|...::||..|| ::.:..|::||     
  Fly   258 NPV-------YFQFSAPFLNCELCGVHQQQLYTCDNCRYRSYCSKSCM-KSDAEVHQYEC----- 309

  Fly   344 MIGSGMSILCFIALRIFTQAPSLEQGLATANLLFEHLCSHEEDRQPDDYLRRAL----MSGFLL 403
             .|..:.::           |.||     ||:||...|      :..:|:..|:    |.|.:|
  Fly   310 -YGYKIGLI-----------PMLE-----ANMLFRLFC------EAGEYILPAIVDYAMDGGIL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150 13/62 (21%)
zf-MYND 299..338 CDD:280009 9/38 (24%)
SET <474..513 CDD:279228
CG18213NP_650589.2 zf-MYND 271..309 CDD:280009 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46165
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.