DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and SmydA-2

DIOPT Version :9

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster


Alignment Length:501 Identity:105/501 - (20%)
Similarity:171/501 - (34%) Gaps:148/501 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 MPGCDATHIALCRKELSSVKPKPKE----ATSEQVPQLAHGESAEL----VGASKVVRLVETKDK 264
            |.....|..|||:.:.|.:....:.    :...|......|..:|.    :..::|:        
  Fly     1 MASTSLTSCALCQAKASQLCAACRNVVYCSREHQKEHWKKGHRSECQCFEIATNEVL-------- 57

  Fly   265 GRFVVANEGLRTGDVLLFEEPVA----ACLEPSYFGTHCHHCFKRLHTPVSCLH-CSGIAFCSAQ 324
            ||.:.|...::.|:.:|.|.|:.    ....|...|  ||........|....| ||.   ||..
  Fly    58 GRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLG--CHRNLLAPGKPRGNYHKCSS---CSWP 117

  Fly   325 CMGEAC--SSYHRFECEYMDLMIGSG-MSILCFIALRIFTQAPSLEQGLATANLLFEHL-CSHEE 385
            ..|:.|  |.:|:.||:   ||.||. .|.:.::        |..|:...:|..:...| |.|.:
  Fly   118 LCGKECEDSVHHKAECQ---LMSGSNFQSKINYV--------PGEEERKESAYCVIMLLRCMHLK 171

  Fly   386 DRQPDDYLRRALMSGFLLRILQKSLYFGRRKTEGVNPTAVELQVATA------------------ 432
            |:.||.:|:...:...|...|:..||                ||..|                  
  Fly   172 DKDPDAFLKLYNLEDHLKERLETPLY----------------QVLRANLITFIKTVLGMKDWPEM 220

  Fly   433 -LLGLLQVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACHF-VGKKLV 495
             :|.:..:|..|..::.|.:...:.|           .||...:..:|:|.|:....| ....:|
  Fly   221 DILRIAAILDTNTFEVRQPRERRKIR-----------ALYPGAAMISHDCVPNMRHRFDDDMNIV 274

  Fly   496 LTATRPHRANELVAVNY-GPIFIKNNLKERQRSLRGRYSFSCSCMACQENWPLLQKLDKQVRFWC 559
            ..|.|.....|:::::| .|:   .:..:|:..||....|.|||..||:                
  Fly   275 FLAKRKIAKGEILSISYTQPL---RSTIQRRVHLRQAKCFDCSCARCQD---------------- 320

  Fly   560 TSANCSNLLKFPKDLAKDVRCPRCRKNISLKESVAKMIKIEELYREA---------ARAMEAQKT 615
                       |::|........|     ||....|:|.:..|...|         .|:.:...|
  Fly   321 -----------PEELGSFAGAQTC-----LKCKAGKIISLNPLLNSAPWKCQLCNFKRSAKDVVT 369

  Fly   616 VEA-IELFKESLDMFFQVAALPHKDTIVAQQSL---HKC-LSDTGT 656
            .:| ::...||||          |.|.||.:..   |:. |.:|.|
  Fly   370 SDAELQQELESLD----------KTTPVALEEFIYRHRADLHETNT 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150
zf-MYND 299..338 CDD:280009 12/41 (29%)
SET <474..513 CDD:279228 9/40 (23%)
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009 6/36 (17%)
SET <246..291 CDD:214614 11/55 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.