DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and SmydA-1

DIOPT Version :9

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_610944.1 Gene:SmydA-1 / 36581 FlyBaseID:FBgn0033917 Length:513 Species:Drosophila melanogaster


Alignment Length:411 Identity:83/411 - (20%)
Similarity:148/411 - (36%) Gaps:84/411 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 RLVETKDKGRFVVANEGLRTGDVLLFEEPVAACLEPSYFGTH-CHHCFKRLHTP--VSCLHCSGI 318
            ::...:..||.:||...::..:::|.|.|:..  .|:..... |..|...:...  :.|..| |.
  Fly    44 KIAHNEQLGRHLVATRTIKPYEIVLKEAPLVR--GPAQISAPVCLGCLNGIEAEDHIECEQC-GW 105

  Fly   319 AFCSAQCMGEACSSYHRFECEYMDLMIGSGMSILCFIALRIFTQAPSLEQGLATANLL------- 376
            ..|..:|..   ...|:.||   .|....|..    :.::.|.....|...|:|...|       
  Fly   106 PLCGPECKS---LDEHKAEC---GLTKDRGQK----VNVQEFGGPHPLYTCLSTVRCLLIGETST 160

  Fly   377 -----FEHLCSHEEDRQPDDYLRRALMSGFLLRILQKSLYFGRRKTEGVNPTAVELQVATALLGL 436
                 |:.|.|.|..|:..:..:..|:|  :.:.:.|  :|..:|.     |..|:..|   :|.
  Fly   161 EKASKFQDLESLESTRRGSNQWKADLVS--IGQFIPK--FFKTQKF-----TEEEIMKA---VGA 213

  Fly   437 LQVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACHF-VGKKLVLTATR 500
            ||:   |.|::..|..:.             ..::.|.|:..:.|.|:.|..| .....:|.|.|
  Fly   214 LQI---NGHEVPTTDPSH-------------VAVFYTASFTENSCLPNLAKSFNKNGHCILWAPR 262

  Fly   501 PHRANELVAVNYGPIFIKNNLKERQRSLRGRYSFSCSCMACQENWPLLQKLDKQV-RFWCTSANC 564
            ..:.|..:::.|.....  ...:|||.|.....|.|:|..|.:    :.:||... ...|....|
  Fly   263 EIKKNAHLSICYSDAMW--GTADRQRHLMQTKLFKCACERCVD----VTELDTNYSAIKCEDRQC 321

  Fly   565 SNLLKFPK--DLAKDVRCPRCRKNISLKESVAKMIKIEELYREAARAMEAQKTVEAIELFKESLD 627
            ..|:...|  :.....||..|.|.:. |..|.::::            .|.|.::::|...|:  
  Fly   322 GGLMLPTKADEWNGSWRCRECHKQVQ-KHYVERILE------------RAGKDIQSMEKIAEN-- 371

  Fly   628 MFFQVAALPHKDTIVAQQSLH 648
               .:..|.|.:..:..|..|
  Fly   372 ---GLKYLKHYEKWLPPQHFH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150
zf-MYND 299..338 CDD:280009 8/40 (20%)
SET <474..513 CDD:279228 9/39 (23%)
SmydA-1NP_610944.1 zf-MYND 4..40 CDD:280009
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.