DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and SmydA-9

DIOPT Version :9

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001285040.1 Gene:SmydA-9 / 31859 FlyBaseID:FBgn0030102 Length:500 Species:Drosophila melanogaster


Alignment Length:440 Identity:93/440 - (21%)
Similarity:151/440 - (34%) Gaps:115/440 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 VGASKVVRLVETKDKGRFVVANEGLRTGDVLLFEEP----VAACLEPSYFGTHCHHCFKRL-HTP 309
            :|.||:.        ||.|||...|:.|:::..:.|    :||..|.|.  ..|..|.|.| .|.
  Fly    27 IGVSKIA--------GRGVVATRSLKRGEIIFRDSPLLIGLAAHEEDSL--NACSVCLKMLPDTR 81

  Fly   310 VSCLHCSGIAFCSAQCMGEACSSYHRFECEYMDLMIGSGMSILCFIALRIFTQAPSLEQGLATAN 374
            ..|....|:..||. |   |....|:.:|:.......:...:...:.:|:...|.::        
  Fly    82 FMCRQGCGLPVCSL-C---AKKKQHKSDCDLFKSWGPNEPDVANSVIIRLLCVARAI-------- 134

  Fly   375 LLFEHLCSHEEDRQPDDYLRRALMSGFLLRILQKSLYFGRRKTEGVN--------PT---AVELQ 428
                :|...:.|               |:..||.:| ....:||..|        ||   .:|:.
  Fly   135 ----NLSKEQRD---------------LIYCLQANL-DNNHRTEVRNAAKCFKNFPTDKKLIEIM 179

  Fly   429 VATALLGLLQVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACHFVGK- 492
            ..|     :.||:.|.......:..:...|:     |.|  ||......||:|.|:....|..| 
  Fly   180 NRT-----VAVLRTNGFDKTTDRTNDNQEFN-----YRA--LYPLFGVVNHDCIPNAYYTFEEKT 232

  Fly   493 -KLVLTATRPHRANELVAVNYGPIFIKNNLKERQRSLRGRYSFSCSCMACQ---ENWPLLQKLDK 553
             .:::.|.........|...|..:|..|  ..|...|:.:.||:|.|..|.   |....:..|  
  Fly   233 NNMIVRAAVDIPEGFEVTTTYTKLFTGN--IARHLFLKMKKSFTCKCSRCSDPTEKGAFISGL-- 293

  Fly   554 QVRFWCTSANCSNL-------LKFPKDLAKDVRCPRCRKNISLKESVAKMIKIEELYREAARAME 611
                :|...||:.|       |..|     :..|..|::    |.:.|:|:|.::....|..|..
  Fly   294 ----YCRDTNCTGLVVPEITGLPHP-----NWNCLVCKQ----KSTHAQMMKSQDFASGAINAKV 345

  Fly   612 AQKTVEA-IELFKESLDMFFQVAALPHKDTIV----------AQQSLHKC 650
            ...::.. ::...|..|.|     :|..:.:|          .||....|
  Fly   346 NSNSLRTLVQYLNEKSDSF-----IPSSNYVVIDAKMSVLQRLQQGREDC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150
zf-MYND 299..338 CDD:280009 12/39 (31%)
SET <474..513 CDD:279228 8/40 (20%)
SmydA-9NP_001285040.1 SET 25..>66 CDD:295368 14/46 (30%)
SET <216..253 CDD:279228 8/36 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452059
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.