DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and SmydA-8

DIOPT Version :9

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001014717.1 Gene:SmydA-8 / 31200 FlyBaseID:FBgn0053548 Length:462 Species:Drosophila melanogaster


Alignment Length:440 Identity:103/440 - (23%)
Similarity:153/440 - (34%) Gaps:135/440 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 GCDAT------HIALCRKELSSVKPKPKEATSEQVPQLAHGESAEL--------VGASKVVRLVE 260
            |.|.|      |:|.||           :.|.||:.||......:|        :.:|.|.    
  Fly    16 GGDTTLAALSAHMAPCR-----------DTTPEQLAQLIDVHLGDLRQEQPNWTISSSTVA---- 65

  Fly   261 TKDKGRFVVANEGLRTGDVLLFEE------PVA------ACLEPSYFGTHCHHCFKRLHTPVSCL 313
                ||.|.|...:..|: |:|:|      |.|      :|:       .||....:  |...|.
  Fly    66 ----GRGVFATRDIAAGE-LIFQERALVTGPTARKGQLSSCI-------CCHETLPQ--TGFLCR 116

  Fly   314 HCSGIAFCSAQCMGEAC--SSYHRFECEYM----------DLMIGSGMSILCFIALRIFTQAPSL 366
            |...:..|      |.|  |..|:.|||:.          :....:.||:....|:|:|      
  Fly   117 HRCTLPVC------ETCSDSEEHQAECEHFRRWQPKDVDAEQEQVNPMSLRILTAVRVF------ 169

  Fly   367 EQGLATANLLFEHLCSHEEDRQPDDYLRRALMSGFLLRILQKSLYFGRRKTEGVNPTAVELQVAT 431
                        ||  .:|.|...|.::......:...|:|.:..|.       |....:.....
  Fly   170 ------------HL--GKEQRHLVDAMQANAERAYRREIIQAAQCFR-------NFPTTDRVFMD 213

  Fly   432 ALLGLLQVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACHFV-GKKLV 495
            .|..::.||..||.:       ...|..|.:|  |..||:...:..||||.|:.:.:|. |:..|
  Fly   214 QLFRIVGVLNTNAFE-------APCRSGGHET--LLRGLFPLTAIMNHECTPNASHYFENGRLAV 269

  Fly   496 LTATRPHRANELVAVNYGPIFIKNNLKERQRSLRGRYSFSCSCMACQ---ENWPLLQKLDKQVRF 557
            :.|.|.......:...|..| :..|| .|...|:....|:|.|:.|.   ||...|..|      
  Fly   270 VRAARDIPKGGEITTTYTKI-LWGNL-TRNIFLKMTKHFACDCVRCHDNTENGTYLSAL------ 326

  Fly   558 WCTSANCSNLLKFP---KDLAKDVRCPRCRKNISLKESV---AKMIKIEE 601
            :|....|..|: .|   :.|..|.||..|       |:|   |||.|.::
  Fly   327 FCREQGCRGLV-IPVQTRTLQPDWRCITC-------ENVFPHAKMAKYQD 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150
zf-MYND 299..338 CDD:280009 10/40 (25%)
SET <474..513 CDD:279228 10/39 (26%)
SmydA-8NP_001014717.1 SET <189..293 CDD:214614 27/120 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452058
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.