DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-2 and Zmynd15

DIOPT Version :9

Sequence 1:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster
Sequence 2:NP_001099270.1 Gene:Zmynd15 / 287457 RGDID:1309845 Length:738 Species:Rattus norvegicus


Alignment Length:285 Identity:63/285 - (22%)
Similarity:90/285 - (31%) Gaps:91/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 QRRAQADKLYLMSGSGDGEESRELLQQALMAANLAVMRAPDRNADPVLDEGLTLALAYRSRASIL 152
            :.|...:|:.|..|......|:||.|:...|....|.:     .:...|||.....|...||...
  Rat   128 EERPGTEKVELQEGGEPAPPSKELPQEVKPAQESEVTQ-----QEASCDEGCREERAEDERAPEK 187

  Fly   153 IRLGEGEAALNDLKLAINFGLELKSSVDYYLKMAKAYAVMGEPARAEISLKIAEKMPGCD----A 213
            .:..:.|||...|...:....|..:.:...|.|..|...:|:             .||.:    .
  Rat   188 RKGRKTEAAPLHLSCLLLVTDEHGTILGIDLLMDGAQGSVGQ-------------SPGTENLAPR 239

  Fly   214 THIALCRK---ELSSVKP-KPKEAT----------SEQVPQLAHGESAELVGASKVVRLVETK-- 262
            .:..||..   .:.|..| ||::.|          ...||:|.             |:|.:|.  
  Rat   240 AYALLCHSMACPMGSGDPRKPRQLTVGDAHLHRELESLVPRLG-------------VKLAKTPMR 291

  Fly   263 ---DKGRFVVANEGLRTGDVLLFEEPVAACLEPSYFGTHCH-HCFKRLHTPVSCLHCSGIAFCSA 323
               .:..|..|:...||..|                   || |.|:...||  |..||.:.:|  
  Rat   292 TWGPRPGFTFASLRARTCHV-------------------CHKHSFEVKLTP--CPQCSAVLYC-- 333

  Fly   324 QCMGEAC----------SSYHRFEC 338
               ||||          ...|||.|
  Rat   334 ---GEACLQADWRRCPDDVSHRFWC 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150 12/62 (19%)
zf-MYND 299..338 CDD:280009 17/49 (35%)
SET <474..513 CDD:279228
Zmynd15NP_001099270.1 zf-MYND 309..355 CDD:280009 18/71 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342701
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.