DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32104 and RBA50

DIOPT Version :9

Sequence 1:NP_648573.2 Gene:CG32104 / 39413 FlyBaseID:FBgn0052104 Length:1215 Species:Drosophila melanogaster
Sequence 2:NP_010816.4 Gene:RBA50 / 852139 SGDID:S000002935 Length:439 Species:Saccharomyces cerevisiae


Alignment Length:388 Identity:91/388 - (23%)
Similarity:147/388 - (37%) Gaps:118/388 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NILGDVKGSKMDPSSLGNVLGELVERTEGTRRSAFPETKNVDSSKPLSIFAKQLLGAKSSTKEKS 170
            ::|||:.......|...|..|.|.....||   .|||   :...|.:|.:.::|...::..|:.|
Yeast     2 DLLGDIVEKDTSDSVESNDNGTLSTNNCGT---GFPE---LYKPKKISSWKERLREKRAQKKKTS 60

  Fly   171 NKVSDFPRNDTSSIIKDAKLGKELHQENLNVLKQMNEQDILTEKERLLASLDPSLIALLSK---K 232
            .|.::..:..|.:.:.:|   |.:|.||:.||:.|:::.|:.|:|.|..||||.|||.|.|   |
Yeast    61 GKDAEKQQTSTDAPLSEA---KSIHNENIKVLQGMSDEQIVQEREDLYNSLDPKLIAKLLKNINK 122

  Fly   233 RQTTPNSKP------------PNPNSPKVIEAPPMP-----------------------AQSTRA 262
            |....|:.|            ...|...:.:.||:.                       .::.:.
Yeast   123 RAKDENNTPLFAEIEGASGTWVGGNKQGIYDLPPLDDEDVDVALEIRPMLGKDAKHVQFEEAGKE 187

  Fly   263 QDPQISSLTDGN------------------------PAIELLQESDKG---------NWLNFN-- 292
            :|.:..:.|:.:                        ..:..::|..:.         |..|||  
Yeast   188 KDVEEEAKTNDDVDDIAPLDFQMAQCIDHMKNEELFKDVHFIKEESQNEINLEKLDINDPNFNDK 252

  Fly   293 LVEEH---------KLAWMRDIPAK---------ISELKPGEQFNARFDWKGVLLPHTLKDQDAS 339
            |.|::         ||.||:.:..|         :||        .|||:.|.|:|.|       
Yeast   253 LHEKYFPDLPKEVDKLKWMQPVQQKTDKNYIIEDVSE--------CRFDFNGDLVPPT------- 302

  Fly   340 KQID---ERELYLHGEEADRPGYALQELFRLARSTVLQQRLSAFGAIAGIFSIYNQGFYDQVL 399
            :|||   ...|:.|.:..:..||.:.||..|||||...||..|...:..|.....|..|.|::
Yeast   303 RQIDSTIHSGLHHHSDSPELAGYTIVELEHLARSTFPSQRCIAIQTLGRILYKLGQKSYYQLV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32104NP_648573.2 RPAP1_N 193..234 CDD:285785 20/43 (47%)
RPAP1_C 319..390 CDD:285784 25/73 (34%)
RBA50NP_010816.4 235kDa-fam <62..>289 CDD:130673 44/229 (19%)
RPAP1_N 80..124 CDD:400787 20/43 (47%)
RPAP1_C 289..357 CDD:400786 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345171
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1894
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005659
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104902
Panther 1 1.100 - - LDO PTHR21483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1069
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.