DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp69a and Obp83ef

DIOPT Version :10

Sequence 1:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:111 Identity:29/111 - (26%)
Similarity:44/111 - (39%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MRCLNQTGA-SVDVIDKSVKNRILPTDPEIKCFLYCMFDMFGLIDSQNIMHLEALLEVL-PEEIH 102
            ::|..|..| :|:::..|   ::...:| |.|...|..|..|..|......||...:.. |....
  Fly   135 LQCSRQLNATNVELLQYS---KLKSKEP-IPCLFQCFADAMGFYDPDGNWRLENWKQAFGPSGNE 195

  Fly   103 KTINGL-VSSC---GTQK--GKDGCDTAYETVKCYIAVNGKFIWEE 142
            ...:|. .|.|   |||:  ....|...|...||:..|||..:.|:
  Fly   196 DQSSGADYSGCRLSGTQREVALSKCSWMYHEYKCWERVNGNKLVED 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp69aNP_524039.2 PhBP 38..135 CDD:214783 25/102 (25%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783
PhBP 133..234 CDD:214783 25/102 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.