DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp69a and Obp56e

DIOPT Version :9

Sequence 1:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_611445.1 Gene:Obp56e / 37267 FlyBaseID:FBgn0034471 Length:132 Species:Drosophila melanogaster


Alignment Length:97 Identity:26/97 - (26%)
Similarity:44/97 - (45%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CLNQTGASVDVIDKSVKNRILPTDPEIKCFLYCMFDMFGLIDSQNIMHLEALLEVLPEEIHKTIN 106
            |:.|.|.:.:............:||::|||..|..:..||:.:..|.....|.::.|......:.
  Fly    36 CVKQEGITKEQAIALRSGNFADSDPKVKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVK 100

  Fly   107 GLVSSCGTQKGKDGCDTAYETVKCYIAVNGKF 138
            .:.:.|.:.||.|.|||:|...|||...:.:|
  Fly   101 EVQAKCDSTKGADKCDTSYLLYKCYYENHAQF 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 25/90 (28%)
Obp56eNP_611445.1 PBP_GOBP 21..128 CDD:279703 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D111689at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.