DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp69a and Obp56b

DIOPT Version :9

Sequence 1:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_611443.1 Gene:Obp56b / 37265 FlyBaseID:FBgn0046880 Length:137 Species:Drosophila melanogaster


Alignment Length:137 Identity:30/137 - (21%)
Similarity:65/137 - (47%) Gaps:21/137 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FFLALLILY---DLIPSNQGVEINPTIIKQVRKLRMRCLNQTGASVDVI--DKSVKNRILPTDPE 67
            :.|.:.:::   :|:......|:  ...||:::..::.||...:..:::  ||.|.|   |:: .
  Fly     5 YLLVVFLIFALSELVAGQSAAEL--AAYKQIQQACIKELNIAASDANLLTTDKEVAN---PSE-S 63

  Fly    68 IKCFLYCMFDMFGLIDSQNIMHLEALLEV-------LPEEIHKTINGLVSSCGTQKGKDGCDTAY 125
            :||:..|::...||:......:.:.::::       ||.:   .:..|::||||.|....||..|
  Fly    64 VKCYHSCVYKKLGLLGDDGKPNTDKIVKLAQIRFSSLPVD---KLKSLLTSCGTTKSAATCDFVY 125

  Fly   126 ETVKCYI 132
            ...||.:
  Fly   126 NYEKCVV 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 28/116 (24%)
Obp56bNP_611443.1 PhBP 35..135 CDD:214783 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.