DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp69a and Obp47a

DIOPT Version :9

Sequence 1:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_610632.1 Gene:Obp47a / 36162 FlyBaseID:FBgn0033573 Length:165 Species:Drosophila melanogaster


Alignment Length:146 Identity:31/146 - (21%)
Similarity:60/146 - (41%) Gaps:41/146 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALLILYDLIPSNQG----VEIN----------PTIIKQVRKLRMRCLNQTGASVDVIDKSVKNR 60
            |.||::..:...::.    :.||          .||.:::.:|   |.:||..|:..::|..:..
  Fly     5 LVLLLVLKMFALSESRFAKININLGLTVADESPKTITEEMIRL---CGDQTDISLRELNKLQRED 66

  Fly    61 ILPTDPEIKCFLYCMFDMFGLIDSQNIMHLEALLEVLPEEIHKTINGLVS-----------SCGT 114
            .......::||.:|:::..||      ||....:|       :.:.||:|           .|..
  Fly    67 FSDPSESVQCFTHCLYEQMGL------MHDGVFVE-------RDLFGLLSDVSNTDYWPERQCHA 118

  Fly   115 QKGKDGCDTAYETVKC 130
            .:|.:.|:|||...:|
  Fly   119 IRGNNKCETAYRIHQC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 28/126 (22%)
Obp47aNP_610632.1 PBP_GOBP 48..132 CDD:279703 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.