powered by:
Protein Alignment Obp69a and Obp28a
DIOPT Version :9
Sequence 1: | NP_524039.2 |
Gene: | Obp69a / 39411 |
FlyBaseID: | FBgn0011279 |
Length: | 148 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_523505.1 |
Gene: | Obp28a / 34031 |
FlyBaseID: | FBgn0011283 |
Length: | 143 |
Species: | Drosophila melanogaster |
Alignment Length: | 51 |
Identity: | 13/51 - (25%) |
Similarity: | 24/51 - (47%) |
Gaps: | 1/51 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 CLNQTGASVDVIDKSVKNRILPTDPEIKCFLYCMFDMFGLIDSQNIMHLEA 92
|:.:.||:...:.:.||.:...|... ||...|:....|::|:...:..||
Fly 38 CMPEVGATDADLQEMVKKQPASTYAG-KCLRACVMKNIGILDANGKLDTEA 87
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.