DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp69a and Obp57d

DIOPT Version :9

Sequence 1:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_725973.1 Gene:Obp57d / 246671 FlyBaseID:FBgn0043536 Length:136 Species:Drosophila melanogaster


Alignment Length:75 Identity:16/75 - (21%)
Similarity:30/75 - (40%) Gaps:18/75 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DLIPSNQGVEINPTIIKQVRKLRMRCLNQTGASVDVIDKSVKNRILPTDPEIKCFLYCMFDMFGL 81
            |..|.|||::         ..:....|....|:||:  .|||.       ..||::.|:...:.:
  Fly    31 DPCPHNQGID---------EDIAESILGDWPANVDL--TSVKR-------SHKCYVTCILQYYNI 77

  Fly    82 IDSQNIMHLE 91
            :.:...:.|:
  Fly    78 VTASGEIFLD 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp69aNP_524039.2 PBP_GOBP 26..133 CDD:279703 11/66 (17%)
Obp57dNP_725973.1 PBP_GOBP <38..131 CDD:279703 12/68 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.