DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ncc69 and slc12a6

DIOPT Version :9

Sequence 1:NP_001261758.1 Gene:Ncc69 / 39410 FlyBaseID:FBgn0036279 Length:1207 Species:Drosophila melanogaster
Sequence 2:XP_009298223.2 Gene:slc12a6 / 100330290 ZFINID:ZDB-GENE-160113-148 Length:226 Species:Danio rerio


Alignment Length:375 Identity:62/375 - (16%)
Similarity:109/375 - (29%) Gaps:174/375 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   704 EEHVKNYRPQILVLSGLPNTRPVLVDLAYMLTKNLSLLVCGHVLKGSSSQKYRTYL--QERAGNW 766
            :.|||:               |.|:..|..|.....|.:.|.|:.|:....|...|  ::...:.
Zfish     3 DAHVKS---------------PRLLTFASQLKAGKGLTIVGTVIPGNFLHTYGEALAAEQTLKHL 52

  Fly   767 FRKHRVKGFYALVDGEDFESGTRALMQATGIGKLKPNIILMGYKTDWQTCDHKELDQYFNVMHKA 831
            ..|.|||||...:..:....|...::|::|:|.:|.|.::||:...|:..:.             
Zfish    53 MEKERVKGFVQCIVAQKPREGISHMIQSSGLGGMKHNTVVMGWPHAWRQSED------------- 104

  Fly   832 LDMYLSVAILRVPQGLDCSQVLGSQDGWKTVSDVPRTLQPNESSGDLQAVDSSVRNGLSGSIDSL 896
                        ||            .|||..:..|                             
Zfish   105 ------------PQ------------SWKTFINTVR----------------------------- 116

  Fly   897 SRNVSQEDRNRNQLVHSEQNSLKIVKLRFKQGLRRMRSWPGAASSTSDLSFIAGNQSKDVSGMPD 961
                                                      .::|:.|:.:.   .|::|..| 
Zfish   117 ------------------------------------------VTTTAHLALLV---LKNISLFP- 135

  Fly   962 PLDAKSANLVSNSLRKSKLKHDDPASLYKGPGGAELPKEVLADLTQFTRKRSHAVIDVWWLYDDG 1026
                      |||                                   ...:...||:||:..||
Zfish   136 ----------SNS-----------------------------------EACTEGFIDIWWIVHDG 155

  Fly  1027 GLTLLLPYIISTRRTWQSCKLRVYALANKNSELEFEQRSMASLLSKFRID 1076
            |:.:|||:::...:.|:.|.||::.:|.........::.:|:.|...|||
Zfish   156 GMLMLLPFLLRQHKVWRKCALRIFTVAQMEDNSIQMKKDLATFLYHLRID 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ncc69NP_001261758.1 AA_permease_N 144..>183 CDD:285588
2a30 155..1207 CDD:273347 62/375 (17%)
ArsB_NhaD_permease <524..>682 CDD:304373
SLC12 724..1207 CDD:281515 59/355 (17%)
slc12a6XP_009298223.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.