DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and Cysltr1

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001268788.1 Gene:Cysltr1 / 58861 MGIID:1926218 Length:352 Species:Mus musculus


Alignment Length:314 Identity:63/314 - (20%)
Similarity:129/314 - (41%) Gaps:64/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KVY--VLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADVLVTWFCIIGEA 183
            :||  :.:|:::....||...::.:.||       .|..||....|.:|:|||:|......:...
Mouse    39 QVYSTMYSVISVVGFFGNSFVLYVLIKT-------YHEKSAFQVYMINLAIADLLCVCTLPLRVV 96

  Fly   184 AWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLNMA--KRCHRLLGG 246
            .:.:..:||..:..|:|.......:||.|.:.:..:...|.:|:.:|::::|:.  |:...:..|
Mouse    97 YYVHKGKWLFGDFLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIG 161

  Fly   247 TYILSLVLSLPQFFIFHVARGPFVEEFYQ-------CVTHGFYTADWQEQMYATF----TLVFTF 300
            .:|..::.|.|  |:.:        :.||       |...   ..:.|.:.|...    :|.|.|
Mouse   162 IWIFVILTSSP--FLMY--------KSYQDEKNNTKCFEP---PQNNQAKKYVLILHYVSLFFGF 213

  Fly   301 LLPLCILFGTYMSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIA 365
            ::|...:...|.....|:           |.|.....:|           ::.|::.:.:|:..|
Mouse   214 IIPFVTIIVCYTMIILTL-----------LKNTMKKNMP-----------SRRKAIGMIIVVTAA 256

  Fly   366 FLICWTPYYVMMIMFM-FLNPDKRLGDD---LQDAIFF---FGMSNSLVNPLIY 412
            ||:.:.||::...:.: .|:.:.|..|.   :|.::..   ...||...:||:|
Mouse   257 FLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVITLSLAASNCCFDPLLY 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 30/134 (22%)
7tm_1 135..412 CDD:278431 59/296 (20%)
Cysltr1NP_001268788.1 7tm_4 47..264 CDD:304433 50/258 (19%)
7tm_1 55..310 CDD:278431 59/296 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.