DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and Ltb4r2

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_006519386.1 Gene:Ltb4r2 / 57260 MGIID:1888501 Length:372 Species:Mus musculus


Alignment Length:412 Identity:92/412 - (22%)
Similarity:155/412 - (37%) Gaps:120/412 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LAVMALFSLLGNLLTIWNI--YKTRISRRNSRHTWSAIYSLMFHLSIAD---VLVT--WFCIIGE 182
            |.:.||..|.||...:|::  ::....|       ....:|:.||::||   :|:|  :...:.:
Mouse    39 LLLAALLGLPGNGFVVWSLAGWRPTAGR-------PLAATLVLHLALADGAVLLLTPLFVAFLSQ 96

  Fly   183 AAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYP-----MKSLNMAKRCHR 242
            .|      |...::.||.|......|:|.|..:..|:.:.|.:||..|     ::|..:|:   |
Mouse    97 EA------WPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALAR---R 152

  Fly   243 LLGGTYILSLVLSLPQFFIFHVARGPFVEEFYQCVTHGFYTADWQEQMYATFTLVFTFLLPLCIL 307
            ||.|.::.:|||::|.....|:..|...:..:....|.        ..:.:...:..|:||...:
Mouse   153 LLLGVWLAALVLAVPAAVYRHLWGGRVCQLCHPSPVHA--------AAHLSLETLTAFVLPFGTV 209

  Fly   308 FGTYMSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICWTP 372
            .|.|..|...:..          |.:.:.:..|:..             |:...|::||.:.|.|
Mouse   210 LGCYGVTLARLRG----------ARWGSGRQGTRVG-------------RLVSAIVLAFGLLWAP 251

  Fly   373 YYVMMIMFMFL------NPDKRLGDDLQ------DAIFFFGMSNSLVNPLIY--GAFHLCPGKGG 423
            |:.:.::....      .|..|||...|      .|:.||   :|.|||::|  .|..|.|..| 
Mouse   252 YHAVNLLQAVAALAPPEGPLARLGGAGQAARAGTTALAFF---SSSVNPVLYVFTAGDLLPRAG- 312

  Fly   424 KSSGGGGNNNAYSLNRGDSQRTPSMLTAVTQVDGTG---GSSRQMRAFRQQSYYRSSSNGTAGPG 485
                                  |..||.:  .:|:|   |.||             |..||....
Mouse   313 ----------------------PRFLTRL--FEGSGEARGGSR-------------SREGTMELR 340

  Fly   486 AAPFKEQVGLLHVGPGNGTPGG 507
            ..|   ::.::..|.|||.|||
Mouse   341 TTP---KLKVMGQGRGNGDPGG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 37/144 (26%)
7tm_1 135..412 CDD:278431 64/300 (21%)
Ltb4r2XP_006519386.1 7tm_GPCRs 33..312 CDD:421689 72/322 (22%)
TM helix 1 34..60 CDD:410628 7/20 (35%)
TM helix 2 69..94 CDD:410628 7/24 (29%)
TM helix 3 106..136 CDD:410628 9/29 (31%)
TM helix 4 148..168 CDD:410628 8/22 (36%)
TM helix 5 190..215 CDD:410628 5/32 (16%)
TM helix 6 229..259 CDD:410628 8/42 (19%)
TM helix 7 279..304 CDD:410628 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.