DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and galr1a

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:XP_696215.1 Gene:galr1a / 567820 ZFINID:ZDB-GENE-060503-290 Length:347 Species:Danio rerio


Alignment Length:319 Identity:76/319 - (23%)
Similarity:138/319 - (43%) Gaps:54/319 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 APQ-----LSRSGLLKVYVLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIA 170
            ||:     :....|:.:.:..::....:|||.|.|     |.:::|......|.....:.:||:|
Zfish    20 APEKNLFGIGTDNLVTLLIFGLIFTLGVLGNSLVI-----TVLAQRKPGQQRSTTNIFILNLSVA 79

  Fly   171 DVLVTWFCIIGEAAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLN 235
            |:....|||..::.......|:.....||.:..|...|:.:|.:.|..:.|||:||:.:..||.:
Zfish    80 DLSYLLFCIPFQSTVYMLPTWILGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYIAIVHCRKSSS 144

  Fly   236 MAKRCHRLLG--GTYILSLVLSLPQFFIFHVARGPFVEEFYQCVTHG-----FYTADW----QEQ 289
            :....|.|:|  ..::||..::.|      ||       :||.:...     |....|    :.:
Zfish   145 IRVARHALIGVLVIWVLSFAMATP------VA-------YYQGIVESEDNSTFCWEVWPDHDRRK 196

  Fly   290 MYATFTLVFTFLLPLCILFGTYMSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMK 354
            :|...|.||.::|||.::...|                :|:.|:...||   .|..:....:|.|
Zfish   197 IYVVCTFVFGYVLPLILISFCY----------------AKVLNHLHKKL---RNVSKKSEASKKK 242

  Fly   355 SLRISVVIIIAFLICWTPYYVMMIMFMFLN-PDKRLGDDLQDAIFFFGMSNSLVNPLIY 412
            :.:..:|:::.|.:.|.|::|:.:...|.: |..:....|:.|......|||.|||:||
Zfish   243 TAQTVLVVVVVFCLSWLPHHVVHLWVEFGSFPLNQASFVLRVAAHCLAYSNSSVNPVIY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 35/134 (26%)
7tm_1 135..412 CDD:278431 70/288 (24%)
galr1aXP_696215.1 7tm_1 49..301 CDD:278431 70/288 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.