DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and gnrhr3

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001170921.1 Gene:gnrhr3 / 564687 ZFINID:ZDB-GENE-090128-1 Length:336 Species:Danio rerio


Alignment Length:315 Identity:94/315 - (29%)
Similarity:168/315 - (53%) Gaps:36/315 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 APQLSRSGLLKVYVLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADVLVT 175
            ||..:.:...:|...|::.:|:...||..:.::.:   |||.:.|    :..|:..|:.||:|:|
Zfish    18 APSFTPAAQARVAATALLFVFAAGSNLALLVSVCR---SRRLASH----LRPLILSLAAADLLMT 75

  Fly   176 WFCIIGEAAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLNMAKRC 240
            :..:..:..|..||||.|.::.|||:...::|::..|.::||.|.:||..|:..|:.:|...:|.
Zfish    76 FVVMPLDMVWNVTVQWYAGDVVCKLLCFLKLFAMQTSAFILVGISLDRHQAILRPLDTLTAPQRN 140

  Fly   241 HRLLGGTYILSLVLSLPQFFIFHVARGPFVEEFYQCVTHGFYTADWQEQMYATFTLVFTFLLPLC 305
            .|.:...:.||.:::.||.||||..:...| :|.||||||.::..|.|..|..|..|..:::||.
Zfish   141 RRRMLTAWSLSALIASPQLFIFHTVKAKSV-DFTQCVTHGSFSERWHETAYNMFHFVTLYVIPLL 204

  Fly   306 ILFGTY----MSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAF 366
            ::...|    :...|.:.:|.|   |..|....|..:|          ||:||:|:::::|:::|
Zfish   205 VMSCCYTCILIEINRQLHNSNK---GDSLRRSGTDMIP----------KARMKTLKMTLIIVLSF 256

  Fly   367 LICWTPYYVMMIMFMF------LNPDKRLGDDLQDAIFFFGMSNSLVNPLIYGAF 415
            ::||||||::.|.:.|      :.|:.     :...:|.||..||..:|:|||.:
Zfish   257 VVCWTPYYLLGIWYWFQPEMLTVTPEY-----VHHLLFVFGNLNSCCDPVIYGLY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 38/132 (29%)
7tm_1 135..412 CDD:278431 86/286 (30%)
gnrhr3NP_001170921.1 7tm_1 43..303 CDD:278431 86/285 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D368588at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.