DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and LTB4R2

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001158164.1 Gene:LTB4R2 / 56413 HGNCID:19260 Length:358 Species:Homo sapiens


Alignment Length:410 Identity:92/410 - (22%)
Similarity:157/410 - (38%) Gaps:112/410 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIAD---VLVTWFCIIGEAAWC 186
            |.:.||..|.||...:|::...|.:|..     ....:|:.||::||   :|:|...:    |:.
Human    27 LLLAALLGLPGNGFVVWSLAGWRPARGR-----PLAATLVLHLALADGAVLLLTPLFV----AFL 82

  Fly   187 YTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYP-----MKSLNMAKRCHRLLGG 246
            ....|...:..||.|......|:|.|..:..|:.:.|.:||..|     ::|..:|:   |||..
Human    83 TRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALAR---RLLLA 144

  Fly   247 TYILSLVLSLPQFFIFHVARGPFVEEFYQCVTHGFYTADWQEQMYATFTLVFTFLLPLCILFGTY 311
            .::.:|:|::|.....|:.|....:..:....|.        ..:.:...:..|:||..::.|.|
Human   145 VWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHA--------AAHLSLETLTAFVLPFGLMLGCY 201

  Fly   312 MSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICWTPYYVM 376
            ..|...:..          |.:.:.:           |.|::.  |:...|::||.:.|.||:.:
Human   202 SVTLARLRG----------ARWGSGR-----------HGARVG--RLVSAIVLAFGLLWAPYHAV 243

  Fly   377 MIM--FMFLNPDK----RLGDDLQ------DAIFFFGMSNSLVNPLIY--GAFHLCPGKGGKSSG 427
            .::  ...|.|.:    :||...|      .|:.||   :|.|||::|  .|..|.|..|     
Human   244 NLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFF---SSSVNPVLYVFTAGDLLPRAG----- 300

  Fly   428 GGGNNNAYSLNRGDSQRTPSMLTAVTQVDGT---GGSSRQMRAFRQQSYYRSSSNGTAGPGAAPF 489
                              |..||.:.:..|.   ||.||:               ||......| 
Human   301 ------------------PRFLTRLFEGSGEARGGGRSRE---------------GTMELRTTP- 331

  Fly   490 KEQVGLLHVGPGNGTPGGSV 509
              |:.::..|.|||.|||.:
Human   332 --QLKVVGQGRGNGDPGGGM 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 36/140 (26%)
7tm_1 135..412 CDD:278431 64/296 (22%)
LTB4R2NP_001158164.1 7tm_GPCRs 21..300 CDD:355774 72/318 (23%)
TM helix 1 23..47 CDD:341315 7/19 (37%)
TM helix 2 58..79 CDD:341315 7/20 (35%)
TM helix 3 95..117 CDD:341315 6/21 (29%)
TM helix 4 140..156 CDD:341315 5/15 (33%)
TM helix 5 179..202 CDD:341315 4/22 (18%)
TM helix 6 220..245 CDD:341315 8/26 (31%)
TM helix 7 267..292 CDD:341315 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 311..358 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.