DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and cysltr1

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001018484.1 Gene:cysltr1 / 553675 ZFINID:ZDB-GENE-050522-250 Length:342 Species:Danio rerio


Alignment Length:308 Identity:67/308 - (21%)
Similarity:134/308 - (43%) Gaps:49/308 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 KVY--VLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADVLVTWFCIIGEA 183
            :||  |.:::.:|.|:||...::.:.:|      .|.| ||.:..|.:|.::|:|......:...
Zfish    16 QVYSTVYSIITVFGLMGNGFALYVLLRT------YRQT-SAFHIYMLNLGVSDLLCVSTLPLRVL 73

  Fly   184 AWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLNMA--KRCHRLLGG 246
            .:....||...:..|:|.......:||.|.:.::.:...|::|:.:|:::|.:|  |:...:...
Zfish    74 YYINKGQWNLGDFLCRLSSYALYVNLYCSVFFMMAMSFTRFLAIVFPVQNLRLATEKKAWIVCVC 138

  Fly   247 TYILSLVLSLPQFFIFHVARGPFVEEFYQCVTHGFYTADWQEQ-----MYATFTLVFTFLLPLCI 306
            .:|...:.|.| |.:......|...:     |..|...:....     |...|:||..|::|..:
Zfish   139 IWIFICMTSSP-FLLSGQHTDPLTNK-----TKCFEPPEKPGSLDKLIMLNYFSLVVGFIIPFLV 197

  Fly   307 LFGTYMSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICWT 371
            :...|....||:           |.|.|.|      |:||.   .:.|::|:.:|:::||||.:.
Zfish   198 ILLCYAGILRTL-----------LRNTSGA------NKQRY---TRNKAIRLIIVVMLAFLISFM 242

  Fly   372 PYYVMMIMFMFLNPDKRLGDD----LQDAIFF---FGMSNSLVNPLIY 412
            ||::...:.:.....|....:    :|.::..   ...:||..:|::|
Zfish   243 PYHIQRTLHLHFKSRKSATCEEVNYMQKSVVITLCLAAANSCFDPMLY 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 29/134 (22%)
7tm_1 135..412 CDD:278431 61/290 (21%)
cysltr1NP_001018484.1 7tm_4 24..244 CDD:304433 56/252 (22%)
7tm_1 32..290 CDD:278431 61/290 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.