DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and Galr1

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_037090.2 Gene:Galr1 / 50577 RGDID:2656 Length:346 Species:Rattus norvegicus


Alignment Length:352 Identity:93/352 - (26%)
Similarity:143/352 - (40%) Gaps:82/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SLAHTNSRHEAPPMAEQVPEHVMDHAPQLSRSGLLKVYVLAVMAL---FSLLGNLLTIWNIYKTR 147
            :|:..|.....|| ||..|         |...|:.....|.|..|   ..:|||.|.|     |.
  Rat     7 NLSEGNGSDPEPP-AEPRP---------LFGIGVENFITLVVFGLIFAMGVLGNSLVI-----TV 56

  Fly   148 ISRRNSRHTWSAIYSLMFHLSIADVLVTWFCIIGEAAWCYTVQWLANELTCKLVKLFQMFSLYLS 212
            ::|.......|.....:.:|||||:....|||..:|.......|:.....||.:..|...|:.:|
  Rat    57 LARSKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVS 121

  Fly   213 TYVLVLIGVDRWIAVKYPMKSLNMAKRCHRLLGGTYI--LSLVLSLPQFFIFHVARGPFVEEFYQ 275
            .:.|..:.|||::|:.:..:|.::....:.|||..:|  ||:.::.|      ||       :||
  Rat   122 IFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGFIWALSIAMASP------VA-------YYQ 173

  Fly   276 CVTH-----GFYTADWQEQM----YATFTLVFTFLLPLCILFGTYMSTFRTISSSEKMFQGSKLA 331
            .:.|     .|....|..|:    |...|.||.:||||.::...|                :|:.
  Rat   174 RLFHRDSNQTFCWEHWPNQLHKKAYVVCTFVFGYLLPLLLICFCY----------------AKVL 222

  Fly   332 NYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICWTPYYVMMIMFMF----LNPDKRLGDD 392
            |:...||   .|..:....:|.|:.:..:|:::.|.|.|.|::|:.:...|    |.|       
  Rat   223 NHLHKKL---KNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHVIHLWAEFGAFPLTP------- 277

  Fly   393 LQDAIFFF-------GMSNSLVNPLIY 412
               |.|||       ..|||.|||:||
  Rat   278 ---ASFFFRITAHCLAYSNSSVNPIIY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 38/137 (28%)
7tm_1 135..412 CDD:278431 78/298 (26%)
Galr1NP_037090.2 7tm_1 49..301 CDD:278431 78/298 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 326..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.