DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and RXFP4

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_871001.1 Gene:RXFP4 / 339403 HGNCID:14666 Length:374 Species:Homo sapiens


Alignment Length:438 Identity:92/438 - (21%)
Similarity:160/438 - (36%) Gaps:113/438 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LSVSTTPLPAYAISNSSSLAHTNSRHEAPPMAEQVPEHVMDHAPQLSRSGLLKVYVLAVMAL--- 130
            |:.|.:| |.:..:|:|..:..::                |.||...:...|::.|.....|   
Human     4 LNTSASP-PTFFWANASGGSVLSA----------------DDAPMPVKFLALRLMVALAYGLVGA 51

  Fly   131 FSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADV-----LVTWFCIIGEAAWCYTVQ 190
            ..|||||..:|     .:|....|.......:.:|:|::||:     |..|   ..|:|..:  .
Human    52 IGLLGNLAVLW-----VLSNCARRAPGPPSDTFVFNLALADLGLALTLPFW---AAESALDF--H 106

  Fly   191 WLANELTCKLVKLFQMFSLYLSTYVLVLIGVDR-WIAVKYPMKSLNMAKRCHRLLGGTYILSLVL 254
            |......||:|....:.::|.|.:::..:.|.| |:.      ::......|..|....|.:|.:
Human   107 WPFGGALCKMVLTATVLNVYASIFLITALSVARYWVV------AMAAGPGTHLSLFWARIATLAV 165

  Fly   255 SLPQFFIFHVARGPFVEEFYQCVTH----GFYTADWQEQMYATFTLVFTFLLPLCILFGTYMSTF 315
            ......: .|....|..|...|...    .|.:..|. ..|....:|..|::||.::..:|:...
Human   166 WAAAALV-TVPTAVFGVEGEVCGVRLCLLRFPSRYWL-GAYQLQRVVLAFMVPLGVITTSYLLLL 228

  Fly   316 RTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICWTPYYVMM--- 377
            ..:...::..|.|::.                     .:|:||   ::.:|.:||.|.:|:.   
Human   229 AFLQRRQRRRQDSRVV---------------------ARSVRI---LVASFFLCWFPNHVVTLWG 269

  Fly   378 IMFMF-LNPDKRLGDDLQDAIF----FFGMSNSLVNPLIY------------GAF-----HLCPG 420
            ::..| |.|.......:|..:|    ....|||.:||::|            |.|     .|.|.
Human   270 VLVKFDLVPWNSTFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQ 334

  Fly   421 KGG-------KSSGGGGNNNAYSLNRGDSQRTPSMLTAVTQVD-GTGG 460
            .||       |..|    ....:.|..:|:  ||  |.:|.:| ||.|
Human   335 GGGWVQQVALKQVG----RRWVASNPRESR--PS--TLLTNLDRGTPG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 30/141 (21%)
7tm_1 135..412 CDD:278431 59/294 (20%)
RXFP4NP_871001.1 7tm_1 56..309 CDD:278431 59/294 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.