DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and Galr2

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_062045.1 Gene:Galr2 / 29234 RGDID:2657 Length:372 Species:Rattus norvegicus


Alignment Length:380 Identity:88/380 - (23%)
Similarity:159/380 - (41%) Gaps:67/380 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 DHAPQLSRSGLLKVYVLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADVL 173
            ::..|...||..:...:.|...|:|:..:.|:.|.....:..|..:.. |.....:.:|.:||:.
  Rat    10 ENTSQEGGSGGWQPEAVLVPLFFALIFLVGTVGNALVLAVLLRGGQAV-STTNLFILNLGVADLC 73

  Fly   174 VTWFCIIGEAAWCYTV-QWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKS--LN 235
            ....|:..:|. .||: .|:...|.||.|......:::.|::.|..:.:||::|::||:.|  |.
  Rat    74 FILCCVPFQAT-IYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELR 137

  Fly   236 MAKRCHRLLGGTYILSLVLSLPQFFIFHVARGPFVEEFYQ------CVTHGFYTADWQEQMYATF 294
            ..:.....:|..:.|:|:.|           ||::..:.|      .|.|..::|..:..| ...
  Rat   138 TPRNALAAIGLIWGLALLFS-----------GPYLSYYRQSQLANLTVCHPAWSAPRRRAM-DLC 190

  Fly   295 TLVFTFLLPLCILFGTYMSTFRTI-SSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRI 358
            |.||::|||:.:|..||..|.|.: .:.:.:..||              ..||    ||.|..|:
  Rat   191 TFVFSYLLPVLVLSLTYARTLRYLWRTVDPVTAGS--------------GSQR----AKRKVTRM 237

  Fly   359 SVVIIIAFLICWTPYYVMMIMFMFLN-PDKRLGDDLQDAIFFFGMSNSLVNPLIY---------G 413
            .:::.:.|.:||.|::.:::...|.. |..|....|:........:||.|||::|         |
  Rat   238 IIIVAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKG 302

  Fly   414 AFHLCPG--------KGGKSSGGGGNNNAYSLNRGDSQRTPSMLTAVTQVDGTGG 460
            ...:|.|        ..|:.|.....|::.|:...:|       |.:|||....|
  Rat   303 FRKICAGLLRPAPRRASGRVSILAPGNHSGSMLEQES-------TDLTQVSEAAG 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 32/135 (24%)
7tm_1 135..412 CDD:278431 68/287 (24%)
Galr2NP_062045.1 7tm_4 32..>177 CDD:304433 35/157 (22%)
7tm_1 42..292 CDD:278431 67/281 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..372
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.