DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and GALR1

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001471.2 Gene:GALR1 / 2587 HGNCID:4132 Length:349 Species:Homo sapiens


Alignment Length:356 Identity:89/356 - (25%)
Similarity:143/356 - (40%) Gaps:79/356 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 AISNSSSLAHTNSRHEAPPMAEQVPEHVMDHAPQLSRSGLLKVYVLAVMAL-FSL--LGNLLTIW 141
            |:.|   |:..|:....||..|..|         |...|:.....|.|..| |:|  |||.|.| 
Human     4 AVGN---LSEGNASWPEPPAPEPGP---------LFGIGVENFVTLVVFGLIFALGVLGNSLVI- 55

  Fly   142 NIYKTRISRRNSRHTWSAIYSLMFHLSIADVLVTWFCIIGEAAWCYTVQWLANELTCKLVKLFQM 206
                |.::|.......|.....:.:|||||:....|||..:|.......|:.....||.:..|..
Human    56 ----TVLARSKPGKPRSTTNLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFT 116

  Fly   207 FSLYLSTYVLVLIGVDRWIAVKYPMKSLNMAKRCHRLL--GGTYILSLVLSLPQFF---IFHVAR 266
            .|:.:|.:.|..:.|||::|:.:..:|.::....:.||  |..:.||:.::.|..:   :||.  
Human   117 VSMLVSIFTLAAMSVDRYVAIVHSRRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHP-- 179

  Fly   267 GPFVEEFYQCVTHGFYTADW----QEQMYATFTLVFTFLLPLCILFGTYMSTFRTISSSEKMFQG 327
                    :.....|....|    .::.|...|.||.:||||.::...|                
Human   180 --------RASNQTFCWEQWPDPRHKKAYVVCTFVFGYLLPLLLICFCY---------------- 220

  Fly   328 SKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICWTPYYVMMIMFMF----LNPDKR 388
            :|:.|:...||   .|..:....:|.|:.:..:|:::.|.|.|.|::::.:...|    |.|   
Human   221 AKVLNHLHKKL---KNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTP--- 279

  Fly   389 LGDDLQDAIFFF-------GMSNSLVNPLIY 412
                   |.|.|       ..|||.|||:||
Human   280 -------ASFLFRITAHCLAYSNSSVNPIIY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 39/137 (28%)
7tm_1 135..412 CDD:278431 71/296 (24%)
GALR1NP_001471.2 7tm_1 50..303 CDD:278431 71/296 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.