DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and Rxfp4

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_861538.1 Gene:Rxfp4 / 242093 MGIID:2182926 Length:414 Species:Mus musculus


Alignment Length:380 Identity:80/380 - (21%)
Similarity:151/380 - (39%) Gaps:96/380 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 MATDISNLSVSTTPLPAYAISNSSSLAHTNSRHEAPPMAEQVPEHVMDHAPQLSRSGLLKVYV-- 124
            |||  ||.|.|   ||.....|.|..:..::...|.|:...|                |::.|  
Mouse     1 MAT--SNSSAS---LPTLFWVNGSGDSVLSTDGAAMPVQFLV----------------LRIMVAL 44

  Fly   125 -LAVMALFSLLGNLLTIWNIYK--TRISRRNSRHTWSAIYSLMFHLSIADV-----LVTWFCIIG 181
             ..::.:..|||||..:|.:..  .|:...:|.       :.:|.|::||:     |..|   ..
Mouse    45 AYGLVGIIGLLGNLAVLWVLGNCGQRVPGLSSD-------TFVFSLALADLGLALTLPFW---AT 99

  Fly   182 EAAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDR-WIAVKYPMKSLNMAKRCHRLLG 245
            |:|..:  .|......||:|....:.|:|.||:::..:.:.| |:.........:::....|::.
Mouse   100 ESAMDF--HWPFGSALCKVVLTTTVLSIYASTFLITALSIARYWVVAMAVGPGSHLSVFWARVVT 162

  Fly   246 -GTYILSLVLSLPQFFIFHVARGPFVEEFYQCVTHGFYTADWQEQMYATFTLVFTFLLPLCILFG 309
             ..::.:.::::|. .||    |..||.:..|:....:.:.:....|....:|..|::||.::..
Mouse   163 LAVWVAAALVTVPT-AIF----GAEVELWGVCLCLLRFPSRYWLGAYQLQRVVLAFIVPLGVITT 222

  Fly   310 TYMSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICWTPYY 374
            :|:.....:...::.             .|.|....|::    .:|:|   |::.:|.:||.|.:
Mouse   223 SYLLLLAFLERQQRC-------------RPRQWQDSRVV----ARSVR---VLVASFALCWVPNH 267

  Fly   375 VMM---IMFMFLNPDKRLGDDL--QDAIFF------------FGMSNSLVNPLIY 412
            |:.   |:..|         ||  .|:.|:            ...|||.:||:||
Mouse   268 VVTLWEILVRF---------DLVPWDSTFYTFHTYILPITTCLAHSNSCLNPVIY 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 28/141 (20%)
7tm_1 135..412 CDD:278431 60/302 (20%)
Rxfp4NP_861538.1 7tm_1 56..313 CDD:278431 60/302 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.