DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and Rxfp3

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_848832.1 Gene:Rxfp3 / 239336 MGIID:2441827 Length:472 Species:Mus musculus


Alignment Length:343 Identity:81/343 - (23%)
Similarity:137/343 - (39%) Gaps:73/343 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SRSGLLKVYVLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTW--SAIYSLMFHLSIAD---VLV 174
            :|..:|...|..|:....|.||||.::.:        .|:..|  |:|...:.:|::.|   ||.
Mouse    78 ARVRILISAVYWVVCALGLAGNLLVLYLM--------KSKQGWRKSSINLFVTNLALTDFQFVLT 134

  Fly   175 TWFCIIGEAAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLNMAKR 239
            ..|..:..|   ...:|...:..||:|.:....::|.|.:.|..:.|.|:.:|...:||.....|
Mouse   135 LPFWAVENA---LDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVARYHSVASALKSHRTRGR 196

  Fly   240 -----CHR------------LLGGTYILSLVLSLPQFFIFHVARGPFVEEFYQCVTH------GF 281
                 |.:            |.|..:..:.:.|||. .||........||.  |:.|      | 
Mouse   197 GRGDCCGQSLRESCCFSAKVLCGLIWASAALASLPN-AIFSTTIRVLGEEL--CLMHFPDKLLG- 257

  Fly   282 YTADWQEQ----MYATFTLVFTFLLPLCILFGTYMSTFRTISSSEKMFQGSKLANYSTAK----L 338
                |..|    :|....::..|||||.|:...|:...|.|  |::...|:..|..:.|.    |
Mouse   258 ----WDRQFWLGLYHLQKVLLGFLLPLSIISLCYLLLVRFI--SDRRVVGTTDAVGAAAAPGGGL 316

  Fly   339 PTQTNRQRLIHKAKMKSLRISVVIIIAFLICWTPYYVM---MIMFMFLNPDKRLGDDLQDAIFFF 400
            .|.:.|:|      .|..:...:::::|.:||.|...:   .|:..| |......:..|..::.|
Mouse   317 STASARRR------SKVTKSVTIVVLSFFLCWLPNQALTTWSILIKF-NAVPFSQEYFQCQVYAF 374

  Fly   401 GM------SNSLVNPLIY 412
            .:      |||.:||::|
Mouse   375 PVSVCLAHSNSCLNPILY 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 35/154 (23%)
7tm_1 135..412 CDD:278431 75/321 (23%)
Rxfp3NP_848832.1 7tm_1 98..392 CDD:278431 75/321 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.