DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and gnrr-3

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_509685.2 Gene:gnrr-3 / 191147 WormBaseID:WBGene00013871 Length:395 Species:Caenorhabditis elegans


Alignment Length:468 Identity:96/468 - (20%)
Similarity:171/468 - (36%) Gaps:137/468 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VMDHAPQLSRSGLLKV-YVLAVMALFSLLGNLLTIWNIYKTRISRRNSRH--TWSAIYSLMFHLS 168
            ||.|    |.|.:::: |.||    |.::|..:.|:...||   .||.|.  ..|.:..|...|.
 Worm    10 VMMH----STSEVIEMFYQLA----FFIIGTPINIFAFVKT---SRNVREGGVESRLVKLSRQLL 63

  Fly   169 IADVLVTWFCIIGEAAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKS 233
            ||.::|.:...|..:.|.|.:.|...::.|::.........:|.:.::..|.:|....:..|:.|
 Worm    64 IAHIMVLFMYGIWRSYWIYNIVWTQGDIMCRVFSFLCALPFHLWSNMVAAIAIDMLCCITSPLSS 128

  Fly   234 LNM-AKRCHRLLGGTYILSLVLSLPQFFIFHVARGPFV---EEFYQCVTHGFYTADWQEQMYATF 294
            ... |.|.:.|:...:..::|.:.|    ..:.||...   |:.|||...   |..:.:.:...|
 Worm   129 YRTGANRVNWLITLAWGFAVVCASP----MSILRGTIQINDEDMYQCYPR---TDVFNDDVLIAF 186

  Fly   295 TL---VFTFLLPLCILFGTYMS---TFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKM 353
            .|   :.:|.:||.|:...|::   :.|...:..::.|....:...|             :..|.
 Worm   187 NLFHVITSFYIPLLIVIICYLAIGVSIRKQMAERRLLQDGGQSGQKT-------------NNTKA 238

  Fly   354 KSLRISVVIIIAFLICWTPYYVMMIMFMFLNPDKRLGDDLQDAIFFFG------MSNSLVNPLIY 412
            :.||.||.||..||..|.||.|:.::.:..     :.::.|:.:....      ::::.:||.:|
 Worm   239 RFLRASVAIICTFLFTWLPYQVLALLRIVC-----VSENCQEIVSKLNWLQAIIIASTCINPFLY 298

  Fly   413 GAFHLCPGKGGKSSGGGGNNNAYSLNRGDSQRTPSMLTAVTQVDGTGGSSRQMRAFRQQSYYRSS 477
             .|...|                                                 ::.|||.|:
 Worm   299 -RFGTEP-------------------------------------------------KRNSYYCST 313

  Fly   478 SNGTAGPGAAPFKEQVGLLHVGPGNGTPGGSVSSGATPQLI----------------------RK 520
            .: |||      ||:|||......:|.|.   .||..||.|                      |:
 Worm   314 MD-TAG------KEEVGLSADRRRSGKPR---PSGLLPQQIAHTENKTPPKCRLEVHAPRFENRR 368

  Fly   521 GSALLARQPSCLR 533
            .|.:.::.|..:|
 Worm   369 ASQIDSKTPKVMR 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 29/135 (21%)
7tm_1 135..412 CDD:278431 61/294 (21%)
gnrr-3NP_509685.2 7tm_classA_rhodopsin-like 62..298 CDD:381740 52/260 (20%)
TM helix 3 94..116 CDD:381740 2/21 (10%)
TM helix 4 138..154 CDD:381740 3/19 (16%)
TM helix 5 184..207 CDD:381740 6/22 (27%)
TM helix 6 238..263 CDD:381740 12/24 (50%)
TM helix 7 276..298 CDD:381740 2/21 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.