DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and Galr3

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_056553.2 Gene:Galr3 / 14429 MGIID:1329003 Length:370 Species:Mus musculus


Alignment Length:307 Identity:68/307 - (22%)
Similarity:128/307 - (41%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADVLVTWFCIIGEAAWCYT 188
            |.|::.|..::||.|.:..:.:...|......:.:.::.|  :|::||:.....|:..:|| .||
Mouse    23 VFALIFLLGMVGNGLVLAVLLQPGPSAWQEPGSTTDLFIL--NLAVADLCFILCCVPFQAA-IYT 84

  Fly   189 VQ-WLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKS--LNMAKRCHRLLGGTYIL 250
            :. ||.....||.|.|....::|.|::.|..:.|||::||::|::|  |...:.....:|..::|
Mouse    85 LDAWLFGAFVCKTVHLLIYLTMYASSFTLAAVSVDRYLAVRHPLRSRALRTPRNARAAVGLVWLL 149

  Fly   251 SLVLSLPQFFIFHVARGPFVEEFYQCVTHG---FYTADWQEQM-----YATFTLVFTFLLPLCIL 307
            :.:.|.|..            .:|..|.:|   .....|::..     .|||..  .:|||:.::
Mouse   150 AALFSAPYL------------SYYGTVRYGALELCVPAWEDARRRALDVATFAA--GYLLPVTVV 200

  Fly   308 FGTYMSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICWTP 372
            ...|               |..|.....|..|..........:|..::.|..:.:...:.:||.|
Mouse   201 SLAY---------------GRTLCFLWAAVGPAGAAAAEARRRATGRAGRAMLTVAALYALCWGP 250

  Fly   373 YYVMMIMFMF----LNPDK---RLGDDLQDAIFFFGMSNSLVNPLIY 412
            ::.:::.|.:    .:|..   ||      |......:||.:|||:|
Mouse   251 HHALILCFWYGRFAFSPATYACRL------ASHCLAYANSCLNPLVY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 35/135 (26%)
7tm_1 135..412 CDD:278431 64/294 (22%)
Galr3NP_056553.2 7tm_4 24..>162 CDD:304433 36/152 (24%)
7tm_1 34..291 CDD:278431 64/294 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..370
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.