DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and Ltb4r2

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_446092.1 Gene:Ltb4r2 / 114098 RGDID:621029 Length:358 Species:Rattus norvegicus


Alignment Length:410 Identity:90/410 - (21%)
Similarity:149/410 - (36%) Gaps:116/410 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LAVMALFSLLGNLLTIWNI--YKTRISRRNSRHTWSAIYSLMFHLSIAD---VLVTWFCIIGEAA 184
            |.:.||..|.||...:|::  ::....|       ....:|:.||::||   :|:|...:    |
  Rat    27 LLLAALLGLPGNGFVVWSLAGWRPTAGR-------PLAATLVLHLALADGAVLLLTPLFV----A 80

  Fly   185 WCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYP-----MKSLNMAKRCHRLL 244
            :.....|...::.||.|......|:|.|..:..|:.:.|.:||..|     ::|..:|:   |||
  Rat    81 FLSRQAWPLGQVGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALAR---RLL 142

  Fly   245 GGTYILSLVLSLPQFFIFHVARGPFVEEFYQCVTHGFYTADWQEQMYATFTLVFTFLLPLCILFG 309
            .|.::.:|||::|.....|:......:..:....|.        ..:.:...:..|:||...:.|
  Rat   143 LGVWLAALVLAVPAAVYRHLWGDRVCQLCHPSAVHA--------AAHLSLETLTAFVLPFGTVLG 199

  Fly   310 TYMSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICWTPYY 374
            .|..|...:..          |.:.:.:..|:..             |:...|::||.:.|.||:
  Rat   200 CYGVTLARLRG----------ARWGSGRQGTRVG-------------RLVSAIVLAFGLLWAPYH 241

  Fly   375 VMMIMFMFL------NPDKRLGDDLQ------DAIFFFGMSNSLVNPLIY--GAFHLCPGKGGKS 425
            .:.::....      .|..|||...|      .|:.||   :|.|||::|  .|..|.|..|   
  Rat   242 AVNLLQAVAALAPPEGPLARLGGAGQAARAGTTALAFF---SSSVNPVLYVFTAGDLLPRAG--- 300

  Fly   426 SGGGGNNNAYSLNRGDSQRTPSMLTAVTQVDG---TGGSSRQMRAFRQQSYYRSSSNGTAGPGAA 487
                                |..||.:.:..|   .|..||:               ||......
  Rat   301 --------------------PRFLTRLFEGSGEARVGSRSRE---------------GTMELRTT 330

  Fly   488 PFKEQVGLLHVGPGNGTPGG 507
            |..:.||   .|.|.|.|||
  Rat   331 PRLKVVG---QGRGYGDPGG 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 37/142 (26%)
7tm_1 135..412 CDD:278431 63/298 (21%)
Ltb4r2NP_446092.1 7tm_GPCRs 21..300 CDD:421689 71/320 (22%)
TM helix 1 22..48 CDD:410628 7/20 (35%)
TM helix 2 57..82 CDD:410628 8/28 (29%)
TM helix 3 94..124 CDD:410628 9/29 (31%)
TM helix 4 136..156 CDD:410628 8/22 (36%)
TM helix 5 178..203 CDD:410628 5/32 (16%)
TM helix 6 217..247 CDD:410628 8/42 (19%)
TM helix 7 267..292 CDD:410628 9/27 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..358 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.