DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CrzR and rxfp3.2b

DIOPT Version :9

Sequence 1:NP_001261755.1 Gene:CrzR / 39409 FlyBaseID:FBgn0036278 Length:644 Species:Drosophila melanogaster
Sequence 2:NP_001077348.1 Gene:rxfp3.2b / 100004589 ZFINID:ZDB-GENE-050208-346 Length:398 Species:Danio rerio


Alignment Length:310 Identity:70/310 - (22%)
Similarity:131/310 - (42%) Gaps:48/310 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 VLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIAD---VLVTWFCIIGEAAW 185
            :.:|:....|:||.|.::.::.      ..||..|:|...:..|::.|   ||...|..:..|  
Zfish    67 IYSVVCALGLVGNSLALYLLHS------RYRHKQSSINCFVMGLALTDLQFVLTLPFWAVDTA-- 123

  Fly   186 CYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLNMAKR------CHRLL 244
             ...:|...::.||::......::|.|.:.|..:.|.|:.::   :.||.|..|      ...:.
Zfish   124 -LDFRWPFGKVMCKIISSVTTMNMYASVFFLTAMSVARYYSI---VSSLKMHSRRAAAAAAKWIS 184

  Fly   245 GGTYILSLVLSLPQFFIFHVARGPFVEEFYQCVTHGFYTADWQEQ----MYATFTLVFTFLLPLC 305
            .|.:::||:.:||......:|:....||.  |:.....|..|..|    :|....::..||:||.
Zfish   185 LGIWVVSLIATLPHAIYSTIAQVATDEEL--CLVRFPETGSWDPQLLLGLYQLQKVLLGFLIPLV 247

  Fly   306 ILFGTYMSTFRTISSSEKMFQGSKLANYSTAKLPTQTNRQRLIHKAKMKSLRISVVIIIAFLICW 370
            ::...|:...|.:.|  :...|       .|...|:..|    ||.:.|..:..||::::|.:||
Zfish   248 VITVCYLLLLRIVLS--RRISG-------VAGSETEQGR----HKRRSKVTKSVVVVVLSFFLCW 299

  Fly   371 TPYYVMM---IMFMF-LNPDKRLGDDLQDAIF----FFGMSNSLVNPLIY 412
            .|...:.   ::..| |.|..:...:.|...|    ....:||.:||::|
Zfish   300 LPNQALTLWGVLIKFDLVPFSKAFYNAQAYAFPLTVCLAHTNSCLNPVLY 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CrzRNP_001261755.1 7tm_4 127..>260 CDD:304433 32/141 (23%)
7tm_1 135..412 CDD:278431 67/297 (23%)
rxfp3.2bNP_001077348.1 7tm_1 78..349 CDD:278431 67/297 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.