powered by:
Protein Alignment CG10418 and LSM10
DIOPT Version :9
Sequence 1: | NP_648570.1 |
Gene: | CG10418 / 39408 |
FlyBaseID: | FBgn0036277 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_116270.1 |
Gene: | LSM10 / 84967 |
HGNCID: | 17562 |
Length: | 123 |
Species: | Homo sapiens |
Alignment Length: | 68 |
Identity: | 21/68 - (30%) |
Similarity: | 41/68 - (60%) |
Gaps: | 2/68 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 KSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGSVVRYVQL 72
:.|.|:...|:|:::....|.:.:||.::||:|..::.| |::.|.:.:.:.|:.|..||||.:
Human 22 QGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYT--DRWGHQVKLDDLFVTGRNVRYVHI 84
Fly 73 PGD 75
|.|
Human 85 PDD 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10418 | NP_648570.1 |
LSm2 |
2..90 |
CDD:212472 |
21/68 (31%) |
LSM10 | NP_116270.1 |
LSm10 |
8..85 |
CDD:212480 |
19/64 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1571169at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.