DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10418 and Lsm2

DIOPT Version :9

Sequence 1:NP_648570.1 Gene:CG10418 / 39408 FlyBaseID:FBgn0036277 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001004073.1 Gene:Lsm2 / 684148 RGDID:1598536 Length:131 Species:Rattus norvegicus


Alignment Length:90 Identity:86/90 - (95%)
Similarity:89/90 - (98%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LFYSFFKSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGSV 66
            ||||||||||||:||||||||||||||||||||||||||||||||||:|||||||||||||||||
  Rat    38 LFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSV 102

  Fly    67 VRYVQLPGDEVDTQLLQDAARKEAV 91
            |||||||.||||||||||||||||:
  Rat   103 VRYVQLPADEVDTQLLQDAARKEAL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10418NP_648570.1 LSm2 2..90 CDD:212472 84/87 (97%)
Lsm2NP_001004073.1 LSm2 38..126 CDD:212472 84/87 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352291
Domainoid 1 1.000 133 1.000 Domainoid score I4965
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48535
Inparanoid 1 1.050 176 1.000 Inparanoid score I3953
OMA 1 1.010 - - QHG54490
OrthoDB 1 1.010 - - D1571169at2759
OrthoFinder 1 1.000 - - FOG0005237
OrthoInspector 1 1.000 - - oto98430
orthoMCL 1 0.900 - - OOG6_103409
Panther 1 1.100 - - LDO PTHR13829
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4249
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.