DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10418 and SNRPD1

DIOPT Version :9

Sequence 1:NP_648570.1 Gene:CG10418 / 39408 FlyBaseID:FBgn0036277 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_008869.1 Gene:SNRPD1 / 6632 HGNCID:11158 Length:119 Species:Homo sapiens


Alignment Length:97 Identity:29/97 - (29%)
Similarity:48/97 - (49%) Gaps:8/97 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFYSFFKSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGS 65
            |....|...|..:.|.:||||...:.||:..||..:|..|..:.:|..::.|  :.::...|||:
Human     1 MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREP--VQLETLSIRGN 63

  Fly    66 VVRYVQLPGD-EVDTQLLQ-----DAARKEAV 91
            .:||..||.. .:||.|:.     .:.::|||
Human    64 NIRYFILPDSLPLDTLLVDVEPKVKSKKREAV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10418NP_648570.1 LSm2 2..90 CDD:212472 25/93 (27%)
SNRPD1NP_008869.1 Sufficient for interaction with CLNS1A. /evidence=ECO:0000269|PubMed:11747828 1..80 25/80 (31%)
Sm_D1 2..93 CDD:212471 25/92 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..119 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.