DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10418 and smx5

DIOPT Version :9

Sequence 1:NP_648570.1 Gene:CG10418 / 39408 FlyBaseID:FBgn0036277 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_571571.1 Gene:smx5 / 57924 ZFINID:ZDB-GENE-000616-10 Length:95 Species:Danio rerio


Alignment Length:90 Identity:87/90 - (96%)
Similarity:89/90 - (98%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFYSFFKSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGS 65
            |||||||||||||:||||||||||||||||||||||||||||||||||:||||||||||||||||
Zfish     1 MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGS 65

  Fly    66 VVRYVQLPGDEVDTQLLQDAARKEA 90
            ||||||||.||||||||||||||||
Zfish    66 VVRYVQLPADEVDTQLLQDAARKEA 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10418NP_648570.1 LSm2 2..90 CDD:212472 84/87 (97%)
smx5NP_571571.1 LSm2 2..90 CDD:212472 84/87 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I5061
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48535
Inparanoid 1 1.050 174 1.000 Inparanoid score I4061
OMA 1 1.010 - - QHG54490
OrthoDB 1 1.010 - - D1571169at2759
OrthoFinder 1 1.000 - - FOG0005237
OrthoInspector 1 1.000 - - oto40440
orthoMCL 1 0.900 - - OOG6_103409
Panther 1 1.100 - - LDO PTHR13829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R666
SonicParanoid 1 1.000 - - X4249
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.