DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10418 and lsm4

DIOPT Version :9

Sequence 1:NP_648570.1 Gene:CG10418 / 39408 FlyBaseID:FBgn0036277 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_989371.1 Gene:lsm4 / 395002 XenbaseID:XB-GENE-945533 Length:138 Species:Xenopus tropicalis


Alignment Length:95 Identity:33/95 - (34%)
Similarity:51/95 - (53%) Gaps:12/95 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFYSFFKSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVT--DPDKYPHMLSVKNCFIR 63
            ||..|..|:.....::|||||..:..|.|.|.|.::||.|.::..|  |.||:..|   ..|:||
 Frog     1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRM---PECYIR 62

  Fly    64 GSVVRYVQLPGDEVDTQLLQDAARKEAVVS 93
            ||.::|:::|.:.:|..       ||.|:|
 Frog    63 GSTIKYLRIPDEIIDMV-------KEEVMS 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10418NP_648570.1 LSm2 2..90 CDD:212472 29/89 (33%)
lsm4NP_989371.1 LSm4 2..77 CDD:212470 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1571169at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.