powered by:
Protein Alignment CG10418 and CG6610
DIOPT Version :9
Sequence 1: | NP_648570.1 |
Gene: | CG10418 / 39408 |
FlyBaseID: | FBgn0036277 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001261461.1 |
Gene: | CG6610 / 38693 |
FlyBaseID: | FBgn0035675 |
Length: | 91 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 18/70 - (25%) |
Similarity: | 36/70 - (51%) |
Gaps: | 6/70 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 VGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYP---HMLSVKNCFIRGSVVRYVQL 72
:|..:.:.:|||..:.|||...|.::|:.|.| ||:.:..| .:..:....:.|:.:..: :
Fly 23 IGSRIHIIMKNDKEMVGTLLGFDDFVNMLLDD--VTEYENTPDGRRITKLDQILLNGNNITML-V 84
Fly 73 PGDEV 77
||.|:
Fly 85 PGGEL 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10418 | NP_648570.1 |
LSm2 |
2..90 |
CDD:212472 |
18/70 (26%) |
CG6610 | NP_001261461.1 |
LSm5 |
12..87 |
CDD:212479 |
16/66 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.