DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10418 and Lsm10

DIOPT Version :9

Sequence 1:NP_648570.1 Gene:CG10418 / 39408 FlyBaseID:FBgn0036277 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_610615.1 Gene:Lsm10 / 36141 FlyBaseID:FBgn0033554 Length:141 Species:Drosophila melanogaster


Alignment Length:87 Identity:18/87 - (20%)
Similarity:40/87 - (45%) Gaps:7/87 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGSVVRYVQLPG 74
            |.|..|:::|.|:.|:.|.:...|.::..:||.....|.:...|...  :..:|..::|.:.:|.
  Fly    23 LQGHSVLIDLHNETSVAGIIDVADGHMTCELTHAVFIDRNGGQHPFD--HFMVRNRMIRQIHIPS 85

  Fly    75 -----DEVDTQLLQDAARKEAV 91
                 .|:.:.:.:...|::.|
  Fly    86 YLDAEQELRSAMERGVLRRKRV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10418NP_648570.1 LSm2 2..90 CDD:212472 17/84 (20%)
Lsm10NP_610615.1 LSm10 7..84 CDD:212480 14/62 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1571169at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.