DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10418 and Sbat

DIOPT Version :9

Sequence 1:NP_648570.1 Gene:CG10418 / 39408 FlyBaseID:FBgn0036277 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001259971.1 Gene:Sbat / 319043 FlyBaseID:FBgn0051950 Length:121 Species:Drosophila melanogaster


Alignment Length:86 Identity:20/86 - (23%)
Similarity:30/86 - (34%) Gaps:30/86 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NDLSICGTLHSVDQY----LNIKLTD-------ISVTDPD---------------KYPHMLSVKN 59
            ||.|:......:.::    |.|.:||       .:.||.|               :.|.:|.  |
  Fly    34 NDASLTPGRRKLQKWLGRVLRIVITDGRVLVGFFNCTDRDANIVLSMCAEYLVEGQEPRLLG--N 96

  Fly    60 CFIRGSVVRYVQLPGDEVDTQ 80
            ..:.|..:  |.|..||.|.|
  Fly    97 VMVPGQHI--VSLSIDEPDPQ 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10418NP_648570.1 LSm2 2..90 CDD:212472 20/86 (23%)
SbatNP_001259971.1 LSMD1 42..110 CDD:212486 13/71 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.