DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10418 and lsm2

DIOPT Version :9

Sequence 1:NP_648570.1 Gene:CG10418 / 39408 FlyBaseID:FBgn0036277 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_588459.1 Gene:lsm2 / 2538804 PomBaseID:SPCC1620.01c Length:96 Species:Schizosaccharomyces pombe


Alignment Length:95 Identity:59/95 - (62%)
Similarity:71/95 - (74%) Gaps:0/95 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLFYSFFKSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGS 65
            ||||||||:|:..||.||||||:||.|.|.||||:||:||.:|||.|..|||||.:||:.|||||
pombe     1 MLFYSFFKTLIDTEVTVELKNDMSIRGILKSVDQFLNVKLENISVVDASKYPHMAAVKDLFIRGS 65

  Fly    66 VVRYVQLPGDEVDTQLLQDAARKEAVVSTR 95
            |||||.:....|||.||.||.|::...:.|
pombe    66 VVRYVHMSSAYVDTILLADACRRDLANNKR 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10418NP_648570.1 LSm2 2..90 CDD:212472 57/87 (66%)
lsm2NP_588459.1 LSm2 2..90 CDD:212472 57/87 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 92 1.000 Domainoid score I2033
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H48535
Inparanoid 1 1.050 115 1.000 Inparanoid score I1537
OMA 1 1.010 - - QHG54490
OrthoFinder 1 1.000 - - FOG0005237
OrthoInspector 1 1.000 - - oto101951
orthoMCL 1 0.900 - - OOG6_103409
Panther 1 1.100 - - LDO PTHR13829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R666
SonicParanoid 1 1.000 - - X4249
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.