powered by:
Protein Alignment CG10418 and LSM5
DIOPT Version :9
Sequence 1: | NP_648570.1 |
Gene: | CG10418 / 39408 |
FlyBaseID: | FBgn0036277 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_036454.1 |
Gene: | LSM5 / 23658 |
HGNCID: | 17162 |
Length: | 91 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 18/69 - (26%) |
Similarity: | 35/69 - (50%) |
Gaps: | 6/69 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 VGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYP---HMLSVKNCFIRGSVVRYVQL 72
:|..:.:.:|:|..|.|||...|.::|:.|.| ||:.:..| .:..:....:.|:.:..: :
Human 22 IGSRIHIVMKSDKEIVGTLLGFDDFVNMVLED--VTEFEITPEGRRITKLDQILLNGNNITML-V 83
Fly 73 PGDE 76
||.|
Human 84 PGGE 87
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10418 | NP_648570.1 |
LSm2 |
2..90 |
CDD:212472 |
18/69 (26%) |
LSM5 | NP_036454.1 |
LSm5 |
11..86 |
CDD:212479 |
16/66 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.