powered by:
Protein Alignment CG10418 and Lsm10
DIOPT Version :9
Sequence 1: | NP_648570.1 |
Gene: | CG10418 / 39408 |
FlyBaseID: | FBgn0036277 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001156738.1 |
Gene: | Lsm10 / 116748 |
MGIID: | 2151045 |
Length: | 122 |
Species: | Mus musculus |
Alignment Length: | 71 |
Identity: | 23/71 - (32%) |
Similarity: | 44/71 - (61%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 KSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGSVVRYVQL 72
:.|.|:...|:|:::....|.:.:||.::||:|.:::.| |::.|.:.:.:.|:.|..||||.:
Mouse 22 QGLQGQITTVDLRDESVARGRIDNVDAFMNIRLANVTYT--DRWGHQVELDDLFVTGRNVRYVHI 84
Fly 73 PGDEVD 78
| |.||
Mouse 85 P-DGVD 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10418 | NP_648570.1 |
LSm2 |
2..90 |
CDD:212472 |
23/71 (32%) |
Lsm10 | NP_001156738.1 |
LSm10 |
8..85 |
CDD:212480 |
19/64 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.