powered by:
Protein Alignment CG10418 and lsm10
DIOPT Version :9
Sequence 1: | NP_648570.1 |
Gene: | CG10418 / 39408 |
FlyBaseID: | FBgn0036277 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373552.1 |
Gene: | lsm10 / 100536270 |
ZFINID: | ZDB-GENE-090508-7 |
Length: | 120 |
Species: | Danio rerio |
Alignment Length: | 71 |
Identity: | 21/71 - (29%) |
Similarity: | 42/71 - (59%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 KSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGSVVRYVQL 72
:.|.|:...|:|:::.:..|.:.:||.::||:|.::... |:.....|:.:.||.|..||||.:
Zfish 22 QGLHGQVTTVDLRDESTARGRVINVDAFMNIRLENVLYR--DRRGRKSSMDDLFITGRNVRYVHI 84
Fly 73 PGDEVD 78
| |:::
Zfish 85 P-DQIN 89
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10418 | NP_648570.1 |
LSm2 |
2..90 |
CDD:212472 |
21/71 (30%) |
lsm10 | NP_001373552.1 |
LSm10 |
8..85 |
CDD:212480 |
19/64 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1571169at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.