DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10418 and lsm10

DIOPT Version :9

Sequence 1:NP_648570.1 Gene:CG10418 / 39408 FlyBaseID:FBgn0036277 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001373552.1 Gene:lsm10 / 100536270 ZFINID:ZDB-GENE-090508-7 Length:120 Species:Danio rerio


Alignment Length:71 Identity:21/71 - (29%)
Similarity:42/71 - (59%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGSVVRYVQL 72
            :.|.|:...|:|:::.:..|.:.:||.::||:|.::...  |:.....|:.:.||.|..||||.:
Zfish    22 QGLHGQVTTVDLRDESTARGRVINVDAFMNIRLENVLYR--DRRGRKSSMDDLFITGRNVRYVHI 84

  Fly    73 PGDEVD 78
            | |:::
Zfish    85 P-DQIN 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10418NP_648570.1 LSm2 2..90 CDD:212472 21/71 (30%)
lsm10NP_001373552.1 LSm10 8..85 CDD:212480 19/64 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1571169at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.