Sequence 1: | NP_729801.1 | Gene: | Lmx1a / 39406 | FlyBaseID: | FBgn0052105 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_013685.1 | Gene: | YOX1 / 854981 | SGDID: | S000004489 | Length: | 385 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 220 | Identity: | 54/220 - (24%) |
---|---|---|---|
Similarity: | 82/220 - (37%) | Gaps: | 74/220 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 425 KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQN 489
Fly 490 GGSGGGSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDSSGYLGGLDSTFASQPLNPNLPFSPD 554
Fly 555 DYPANSNDSFCSSDLSLDGSNFDQLDDDADSLSLNN--------LELQSTSSS--GNQHSHSHSN 609
Fly 610 PH-----DMLANLN---NSLINPID 626 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lmx1a | NP_729801.1 | LIM1_Lmx1b | 275..327 | CDD:188757 | |
LIM | 333..388 | CDD:295319 | |||
Homeobox | 427..480 | CDD:278475 | 18/52 (35%) | ||
YOX1 | NP_013685.1 | COG5576 | 126..267 | CDD:227863 | 33/140 (24%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3844 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |