DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and DAR5

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_201464.2 Gene:DAR5 / 836795 AraportID:AT5G66630 Length:702 Species:Arabidopsis thaliana


Alignment Length:173 Identity:37/173 - (21%)
Similarity:60/173 - (34%) Gaps:39/173 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 DCSGRTEVGHIKCEKN--FELCEGCGQKIHDRFLMNVGDANWHEQCLACCYCG--MQLHH-TCYV 315
            :|....|......|.|  ..:|.||...:.....:|:....||..|..|..|.  :.:|. ..:|
plant   326 ECRDEIEENEKLPEVNPPLSMCGGCNSAVKHEESVNILGVLWHPGCFCCRSCDKPIAIHELENHV 390

  Fly   316 RNSK-LYCKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFV--------CYACRLPLQ 371
            .||: .:.|..|:|.        |:....:::....|..|.....|.|        |.:|.....
plant   391 SNSRGKFHKSCYERY--------CYVCKEKKMKTYNIHPFWEERYCPVHEADGTPKCCSCERLEP 447

  Fly   372 KGEQF-MLRDGQLFCYRHDLEKEMFLAAAAAQHCGFVGLDEED 413
            :|.:: .|.||:..|    ||            ||...:|.::
plant   448 RGTKYGKLSDGRWLC----LE------------CGKSAMDSDE 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 14/55 (25%)
LIM 333..388 CDD:295319 12/63 (19%)
Homeobox 427..480 CDD:278475
DAR5NP_201464.2 RPW8 7..147 CDD:283345
LIM_DA1 347..402 CDD:188782 14/54 (26%)
DUF3633 488..700 CDD:289113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.