DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and HB5

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_201334.1 Gene:HB5 / 836656 AraportID:AT5G65310 Length:312 Species:Arabidopsis thaliana


Alignment Length:231 Identity:57/231 - (24%)
Similarity:96/231 - (41%) Gaps:47/231 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 FLAAAAAQHCG-FVGLDEEDLLRPRDG------RRGPKRPRTILTSQQRKQFKASF--DQSPKPC 450
            ||.:.|..:.. |..|:::..|....|      ....|:.|  |..:|.|..:.:|  |...:|.
plant    35 FLYSGAGDYSQMFDALEDDGSLEDLGGVGHASSTAAEKKRR--LGVEQVKALEKNFEIDNKLEPE 97

  Fly   451 RKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTND 515
            |||:  ||::.||..|.|.:||||:||:.|  .::.:::.|....:.........|...|.|:..
plant    98 RKVK--LAQELGLQPRQVAIWFQNRRARWK--TKQLERDYGVLKSNFDALKRNRDSLQRDNDSLL 158

  Fly   516 KEDKCVKQEL------GGDSSGYLGGLDSTFASQPLNPNL----------PFSPDDYPANSNDSF 564
            .:.|.:|.:|      |.:.:|.|..:::..:....|..|          |..|.|.|       
plant   159 GQIKELKAKLNVEGVKGIEENGALKAVEANQSVMANNEVLELSHRSPSPPPHIPTDAP------- 216

  Fly   565 CSSDLSLD-------GSNF-DQLDDDADSLSLNNLE 592
             :|:|:.:       ..|| |...|.:||.::.|.|
plant   217 -TSELAFEMFSIFPRTENFRDDPADSSDSSAVLNEE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 22/54 (41%)
HB5NP_201334.1 Homeobox 79..125 CDD:278475 20/47 (43%)
HALZ 127..168 CDD:280364 6/40 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.