DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and AT4G36860

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001328324.1 Gene:AT4G36860 / 829839 AraportID:AT4G36860 Length:577 Species:Arabidopsis thaliana


Alignment Length:341 Identity:66/341 - (19%)
Similarity:120/341 - (35%) Gaps:85/341 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LCEGCGQKI-HDRFLMNVGDANWHEQCLACCYCGMQ-LHHTCYVRNSKLYCKMDYDRLFGVKCSS 336
            :|.||..:| |.|||..:|.. ||.:|..|..|... :.:...:..::.|.|:.|......|| .
plant   213 ICVGCQAEIGHGRFLSCMGGV-WHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKC-D 275

  Fly   337 CCHAILPQE----LVMRPIPNFVFHLPCFV----------CYAC-RLPLQKGEQFMLRDGQLFCY 386
            .||..:|..    :..|..|   |.:..:.          |.:| |:..:..:..:|.||:..|.
plant   276 VCHNFIPTNPAGLIEYRAHP---FWMQKYCPSHERDGTPRCCSCERMEPKDTKYLILDDGRKLCL 337

  Fly   387 R---------HDLE------KEMF--LAAAAAQHCGFVGLDEEDLLRPRDGR----------RG- 423
            .         |:.:      :|.:  |.....|....:.::...|....:|.          || 
plant   338 ECLDSAIMDTHECQPLYLEIREFYEGLHMKVEQQIPMLLVERSALNEAMEGEKHGHHHLPETRGL 402

  Fly   424 -PKRPRTILTSQQRKQFKASF---DQSPKPCRKVREA-------------LAKDTGLSVRVVQVW 471
             ....:|:.|..:|.:..|.:   |...:|||.:|..             |...:.|:..::..|
plant   403 CLSEEQTVTTVLRRPRIGAGYKLIDMITEPCRLIRRCEVTAILILYGLPRLLTGSILAHEMMHAW 467

  Fly   472 -----FQNQRAKMKK--------IQRKAKQNGGS-----GGGSGSGRGTGNSSATDDKDTNDKED 518
                 :.|.|.::::        :..:::...||     ...|.|...:.:|...:..|...|..
plant   468 LRLNGYPNLRPEVEEGICQVLAHMWLESETYAGSTLVDIASSSSSAVVSASSKKGERSDFEKKLG 532

  Fly   519 KCVKQELGGDSSGYLG 534
            :..|.::..|||...|
plant   533 EFFKHQIESDSSSAYG 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 16/53 (30%)
LIM 333..388 CDD:295319 15/78 (19%)
Homeobox 427..480 CDD:278475 14/73 (19%)
AT4G36860NP_001328324.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.