DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and HB21

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_179445.1 Gene:HB21 / 816370 AraportID:AT2G18550 Length:220 Species:Arabidopsis thaliana


Alignment Length:165 Identity:37/165 - (22%)
Similarity:59/165 - (35%) Gaps:62/165 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 LTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMK--------------- 480
            |:.:|.:..:.||:...|...:.::.||.:.||..|.|.|||||:||:.|               
plant    65 LSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYTKLKNAY 129

  Fly   481 --------------------------KIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTNDKEDK 519
                                      :|||.||:..|:...|..     :||.|.:         
plant   130 ETTVVEKCRLDSEVIHLKEQLYEAEREIQRLAKRVEGTLSNSPI-----SSSVTIE--------- 180

  Fly   520 CVKQELGGDSSGYLGGLDSTFASQPLNPNLPFSPD 554
                  ...::.:.|..|..|..: .:.||.:|||
plant   181 ------ANHTTPFFGDYDIGFDGE-ADENLLYSPD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 18/48 (38%)
HB21NP_179445.1 HOX 61..114 CDD:197696 18/48 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.