DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Zfhx4

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001355600.1 Gene:Zfhx4 / 80892 MGIID:2137668 Length:3607 Species:Mus musculus


Alignment Length:251 Identity:61/251 - (24%)
Similarity:94/251 - (37%) Gaps:60/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 DEED--LLRPRDGRRG-----PKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRV 467
            |:||  ......|..|     .||.||.:|.:|.:.....:.....|.||:.:.:|::.||..||
Mouse  2578 DKEDNNCSEKEGGNSGEDQHRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAREVGLKKRV 2642

  Fly   468 VQVWFQNQRAKMKKIQRKAKQNGGS--------------------------GGGSGSGRGTGNSS 506
            |||||||.||:.:|.|.:|.....|                          ..|..:|.....|.
Mouse  2643 VQVWFQNTRARERKGQFRAVGPAQSHKRCPFCRALFKAKSALESHIRSRHWNEGKQAGYSLPPSP 2707

  Fly   507 ATDDKDTNDKEDKCV----------KQELGGDSSGYLGGLDSTFASQ--PLNPNLPFSPDDYPAN 559
            ....:|..:...|.:          |.:|..::.  |....||..|:  .|:|....||..:.|.
Mouse  2708 LISTEDGGESPQKYIYFDYPSLPLTKIDLSTENE--LASTVSTPVSKTAELSPKNLLSPSSFKAE 2770

  Fly   560 SNDSFCSSDL------SLDGSNFDQLDDDADSLSLNNLELQSTSSSGNQHSHSHSN 609
                 |..|:      |.| :.:||...|.|..|..|..: |.:::|::.:....|
Mouse  2771 -----CPEDVENLNAPSAD-AGYDQSKTDFDETSSINTAI-SDATTGDEGAADMEN 2819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 21/52 (40%)
Zfhx4NP_001355600.1 C2H2 Zn finger 613..634 CDD:275368
C2H2 Zn finger 644..665 CDD:275368
C2H2 Zn finger 699..716 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275371
C2H2 Zn finger 1424..1441 CDD:275371
SFP1 <1468..1608 CDD:227516
C2H2 Zn finger 1540..1564 CDD:275368
C2H2 Zn finger 1592..1610 CDD:275368
COG5576 2098..2237 CDD:227863
HOX 2127..2182 CDD:197696
Homeobox 2226..2280 CDD:395001
COG5576 2536..>2658 CDD:227863 29/79 (37%)
Homeobox 2603..2656 CDD:395001 21/52 (40%)
Homeobox 2926..2979 CDD:395001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.